DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis of FFAT motif-mediated ER targeting. Structural basis of FFAT motif-mediated ER targeting. Structure (London, England : 1993) 2005 imex curation Kaiser SE., Brickner JH., Reilein AR., Fenn TD., Walter P., Brunger AT. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Kaiser SE., Brickner JH., Reilein AR., Fenn TD., Walter P., Brunger AT. DIP original experiment: DIP-132814X Structure (London, England : 1993) 2005 IMEx Structural basis of FFAT motif-mediated ER targeting. Structural basis of FFAT motif-mediated ER targeting. Structural basis of FFAT motif-mediated ER targeting. Structure (London, England : 1993) 2005 imex curation Kaiser SE., Brickner JH., Reilein AR., Fenn TD., Walter P., Brunger AT. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Kaiser SE., Brickner JH., Reilein AR., Fenn TD., Walter P., Brunger AT. DIP original experiment: DIP-132816X Structure (London, England : 1993) 2005 IMEx Structural basis of FFAT motif-mediated ER targeting. Structural basis of FFAT motif-mediated ER targeting. Structural basis of FFAT motif-mediated ER targeting. Structure (London, England : 1993) 2005 imex curation Kaiser SE., Brickner JH., Reilein AR., Fenn TD., Walter P., Brunger AT. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kaiser SE., Brickner JH., Reilein AR., Fenn TD., Walter P., Brunger AT. DIP original experiment: DIP-132817X Structure (London, England : 1993) 2005 IMEx Structural basis of FFAT motif-mediated ER targeting. Structural basis of FFAT motif-mediated ER targeting. Structural basis of FFAT motif-mediated ER targeting. Structure (London, England : 1993) 2005 imex curation Kaiser SE., Brickner JH., Reilein AR., Fenn TD., Walter P., Brunger AT. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Kaiser SE., Brickner JH., Reilein AR., Fenn TD., Walter P., Brunger AT. DIP original experiment: DIP-132818X Structure (London, England : 1993) 2005 IMEx Structural basis of FFAT motif-mediated ER targeting. Structural basis of FFAT motif-mediated ER targeting. Structural basis of FFAT motif-mediated ER targeting. Structure (London, England : 1993) 2005 imex curation Kaiser SE., Brickner JH., Reilein AR., Fenn TD., Walter P., Brunger AT. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kaiser SE., Brickner JH., Reilein AR., Fenn TD., Walter P., Brunger AT. DIP original experiment: DIP-132813X Structure (London, England : 1993) 2005 IMEx Structural basis of FFAT motif-mediated ER targeting. Structural basis of FFAT motif-mediated ER targeting. Structural basis of FFAT motif-mediated ER targeting. Structure (London, England : 1993) 2005 imex curation Kaiser SE., Brickner JH., Reilein AR., Fenn TD., Walter P., Brunger AT. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Kaiser SE., Brickner JH., Reilein AR., Fenn TD., Walter P., Brunger AT. DIP original experiment: DIP-132812X Structure (London, England : 1993) 2005 IMEx Structural basis of FFAT motif-mediated ER targeting. Structural basis of FFAT motif-mediated ER targeting. Structural basis of FFAT motif-mediated ER targeting. Structure (London, England : 1993) 2005 imex curation Kaiser SE., Brickner JH., Reilein AR., Fenn TD., Walter P., Brunger AT. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kaiser SE., Brickner JH., Reilein AR., Fenn TD., Walter P., Brunger AT. DIP original experiment: DIP-132815X Structure (London, England : 1993) 2005 IMEx Structural basis of FFAT motif-mediated ER targeting. Structural basis of FFAT motif-mediated ER targeting. Structural basis of FFAT motif-mediated ER targeting. Structure (London, England : 1993) 2005 imex curation Kaiser SE., Brickner JH., Reilein AR., Fenn TD., Walter P., Brunger AT. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kaiser SE., Brickner JH., Reilein AR., Fenn TD., Walter P., Brunger AT. DIP original experiment: DIP-132811X Structure (London, England : 1993) 2005 IMEx Structural basis of FFAT motif-mediated ER targeting. Structural basis of FFAT motif-mediated ER targeting. Structural basis of FFAT motif-mediated ER targeting. Structure (London, England : 1993) 2005 imex curation Kaiser SE., Brickner JH., Reilein AR., Fenn TD., Walter P., Brunger AT. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Kaiser SE., Brickner JH., Reilein AR., Fenn TD., Walter P., Brunger AT. DIP original experiment: DIP-132819X Structure (London, England : 1993) 2005 IMEx Structural basis of FFAT motif-mediated ER targeting. opi1_yeast Transcriptional repressor OPI1 OPI1 YHL020C Overproducer of inositol protein 1 Negative regulator of phospholipid biosynthesis protein protein yeast Saccharomyces cerevisiae Baker's yeast MSENQRLGLSEEEVEAAEVLGVLKQSCRQKSQPSEDVSQADKMPASESSTTPLNILDRVSNKIISNVVTFYDEINTNKRPLKSIGRLLDDDDDEHDDYDYNDDEFFTNKRQKLSRAIAKGKDNLKEYKLNMSIESKKRLVTCLHLLKLANKQLSDKISCLQDLVEKEQVHPLHKQDGNARTTTGAGEDETSSDEDDDDEEFFDASEQVNASEQSIVVKMEVVGTVKKVYSLISKFTANSLPEPARSQVRESLLNLPTNWFDSVHSTSLPHHASFHYANCEEQKVEQQQQQQQQQQQQQLLQQQLLQQQQQKRNKDGDDSASPSSSVTANGKVLILAKESLEMVRNVMGVVDSTLGKAEEWVKQKQEVKEMIRERFLQQQQQYRQQQQKDGNYVKPSQDNVDSKD 59E55D7BE7122EDA 59E55D7BE7122EDA vapa_rat Vesicle-associated membrane protein-associated protein A Vapa Vap33 33 kDa VAMP-associated protein protein protein rat Rattus norvegicus (Rat) Rat MASASGAMAKHEQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPLPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSAVSFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL DIP protein Q9Z270 original sequence version: 74 A30D08E31F3379C1 osbl1_rat Oxysterol-binding protein-related protein 1 Osbpl1a Orp1 protein protein rat Rattus norvegicus (Rat) Rat MNTEAEQQLLHHARNGNAEEVRKLLEAMARAEVVADIDCKGRSKSNLGWTPLHLACYFGHKQVVQDLLKAGAKVNMLNDMGDTPLHRAAFTGRKELVMLLLEYNADTTVVNGSGQTAKEATHDKEIRQMLEAVERTQQRKLEELLLGAAREGRTAEVSALLSRPNPPDVNCSDQLGNTPLHCAAYRAHKQCVLKLLRSGADPSLKNKNDQKPLDLAHGTEMKHILVGNKVVHKALKRFEGPLWKSSRFFGWKLFWVVLEHGVLSWYRKQPDAVHNSYRQGCKHLTQAVCTVKPTDGCLFSVRCFDDTVHGFRVPKNSLQQSREKWLEAIEEHSAYSTHYCSQDQVTDDEEEDVASAMDLKESLARAQTCQQRLDREIYNFLKMIKECDVAKDMLPSFLQKADVLSEASRETCVALSDCLNLFTKQEGVRNFKLEQEQEKNKILSEALETLATEHHELERSLVEGSPPVSILSEDEFYDALSGSESEGSLTCLEAVTARAFEENEVPANSGKHRMSEGKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSFSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVRDDLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSIYPKLKFWGKSVEAEPKGTITLELLEHNEAYTWTNPTCCVHNIIVGKLWIEQYGNVEIINHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALYGKWTECLYSVDPATFDAYKKNDKKNTEEKKTSKQASTSEESDEMPVPDSESVFVIPGSALLWRIAPRPPNSAQMYNFTSFAMVLNEVDKEMETVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRSKSEEDWKTRWFHQGPNPYSGAQDWIYSGSYWDRNYFNLPDIY DIP protein Q8K4M9 original sequence version: 41 scs2_yeast Vesicle-associated membrane protein-associated protein SCS2 YER120W SCS2 VAP homolog 1 Choline sensitivity suppressor protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAVEISPDVLVYKSPLTEQSTEYASISNNSDQTIAFKVKTTAPKFYCVRPNAAVVAPGETIQVQVIFLGLTEEPAADFKCRDKFLVITLPSPYDLNGKAVADVWSDLEAEFKQQAISKKIKVKYLISPDVHPAQNQNIQENKETVEPVVQDSEPKEVPAVVNEKEVPAEPETQPPVQVKKEEVPPVVQKTVPHENEKQTSNSTPAPQNQIKEAATVPAENESSSMGIFILVALLILVLGWFYR 45390E24E31D392E 45390E24E31D392E osbpl1a-vapa-1 5 11 unspecified role unspecified role unspecified role unspecified role MSP-domain Region 8-132 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain The range was adjusted to match the Uniprot entry. ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role FFAT motif Region 472-481 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction osbpl1a-vapa-2 8 11 unspecified role unspecified role unspecified role unspecified role MSP-domain Region 8-132 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain The range was adjusted to match the Uniprot entry. ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role FFAT motif Region 454-546 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction vapa-1 3 11 unspecified role unspecified role unspecified role unspecified role MSP and CC-domain Region 8-226 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction osbpl1a-vapa-3 7 11 unspecified role unspecified role unspecified role unspecified role MSP-domain Region 8-132 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain The range was adjusted to match the Uniprot entry. ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role FFAT motif Region 472-481 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction vapa-2 4 11 unspecified role unspecified role unspecified role unspecified role MSP and CC-domain Region 8-226 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction osbpl1a-vapa-4 1 11 unspecified role unspecified role unspecified role unspecified role MSP-domain Region 8-132 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain The range was adjusted to match the Uniprot entry. ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role FFAT motif Region 472-481 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction osbpl1a-vapa-5 6 11 unspecified role unspecified role unspecified role unspecified role MSP-domain Region 8-132 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain The range was adjusted to match the Uniprot entry. ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role FFAT motif Region 454-546 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction osbpl1a-vapa-6 2 11 unspecified role unspecified role unspecified role unspecified role MSP-domain Region 8-132 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain The range was adjusted to match the Uniprot entry. Q9Z270:p.[Lys94Asp;Met96Asp] K94D/M96D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M D certain certain sequence position certain certain certain sequence position certain K D The positions were changed to match the correct Uniprot entry. This feature has been corrected as a result of our quality control procedures. The original label was 'K94D/M96D'. Wed May 02 15:21:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys94asp,met96asp' Tue Jun 30 20:19:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys94Asp;Met96Asp]' ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role FFAT motif Region 472-481 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction opi2p-scs2p-1 9 10 unspecified role unspecified role unspecified role unspecified role FFAT motif Region 197-206 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 13 unspecified role unspecified role unspecified role unspecified role Region 1-224 Region 1-224 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P40075:p.[Lys84Asp;Leu86Asp] K84D/L86D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L D certain certain sequence position certain certain certain sequence position certain K D This feature has been corrected as a result of our quality control procedures. The original label was 'K84D/L86D'. Wed May 02 18:49:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys84asp,leu86asp' Tue Jun 30 18:44:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys84Asp;Leu86Asp]' ecolx Escherichia coli direct interaction direct interaction