DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of nicotinic acetylcholine receptor homolog AChBP in complex with an alpha-conotoxin PnIA variant. Crystal structure of nicotinic acetylcholine receptor homolog AChBP in complex with an alpha-conotoxin PnIA variant. Nature structural & molecular biology 2005 imex curation Celie PH., Kasheverov IE., Mordvintsev DY., Hogg RC., van Nierop P., van Elk R., van Rossum-Fikkert SE., Zhmak MN., Bertrand D., Tsetlin V., Sixma TK., Smit AB. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Celie PH., Kasheverov IE., Mordvintsev DY., Hogg RC., van Nierop P., van Elk R., van Rossum-Fikkert SE., Zhmak MN., Bertrand D., Tsetlin V., Sixma TK., Smit AB. DIP original experiment: DIP-254766X Nature structural & molecular biology 2005 IMEx Crystal structure of nicotinic acetylcholine receptor homolog AChBP in complex with an alpha-conotoxin PnIA variant. Crystal structure of nicotinic acetylcholine receptor homolog AChBP in complex with an alpha-conotoxin PnIA variant. Crystal structure of nicotinic acetylcholine receptor homolog AChBP in complex with an alpha-conotoxin PnIA variant. Nature structural & molecular biology 2005 imex curation Celie PH., Kasheverov IE., Mordvintsev DY., Hogg RC., van Nierop P., van Elk R., van Rossum-Fikkert SE., Zhmak MN., Bertrand D., Tsetlin V., Sixma TK., Smit AB. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Celie PH., Kasheverov IE., Mordvintsev DY., Hogg RC., van Nierop P., van Elk R., van Rossum-Fikkert SE., Zhmak MN., Bertrand D., Tsetlin V., Sixma TK., Smit AB. DIP original experiment: DIP-254765X Nature structural & molecular biology 2005 IMEx Crystal structure of nicotinic acetylcholine receptor homolog AChBP in complex with an alpha-conotoxin PnIA variant. Crystal structure of nicotinic acetylcholine receptor homolog AChBP in complex with an alpha-conotoxin PnIA variant. Crystal structure of nicotinic acetylcholine receptor homolog AChBP in complex with an alpha-conotoxin PnIA variant. Nature structural & molecular biology 2005 imex curation Celie PH., Kasheverov IE., Mordvintsev DY., Hogg RC., van Nierop P., van Elk R., van Rossum-Fikkert SE., Zhmak MN., Bertrand D., Tsetlin V., Sixma TK., Smit AB. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Celie PH., Kasheverov IE., Mordvintsev DY., Hogg RC., van Nierop P., van Elk R., van Rossum-Fikkert SE., Zhmak MN., Bertrand D., Tsetlin V., Sixma TK., Smit AB. DIP original experiment: DIP-254764X Nature structural & molecular biology 2005 IMEx Crystal structure of nicotinic acetylcholine receptor homolog AChBP in complex with an alpha-conotoxin PnIA variant. Crystal structure of nicotinic acetylcholine receptor homolog AChBP in complex with an alpha-conotoxin PnIA variant. Crystal structure of nicotinic acetylcholine receptor homolog AChBP in complex with an alpha-conotoxin PnIA variant. Nature structural & molecular biology 2005 imex curation Celie PH., Kasheverov IE., Mordvintsev DY., Hogg RC., van Nierop P., van Elk R., van Rossum-Fikkert SE., Zhmak MN., Bertrand D., Tsetlin V., Sixma TK., Smit AB. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Celie PH., Kasheverov IE., Mordvintsev DY., Hogg RC., van Nierop P., van Elk R., van Rossum-Fikkert SE., Zhmak MN., Bertrand D., Tsetlin V., Sixma TK., Smit AB. DIP original experiment: DIP-254763X Nature structural & molecular biology 2005 IMEx Crystal structure of nicotinic acetylcholine receptor homolog AChBP in complex with an alpha-conotoxin PnIA variant. achp_lymst Acetylcholine-binding protein protein protein lymst Lymnaea stagnalis Helix stagnalis MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL DIP protein P58154 original sequence version: 78 mint Binds to acetylcholine. Modulates neuronal synaptic transmission B76A3A13E7EF8FCB ca1a_conpe Alpha-conotoxin PnIA protein protein conpe Conus pennaceus Feathered cone Conus episcopus GCCSLPPCAANNPDYC DIP protein P50984 original sequence version: 71 q8wsf8_aplca protein protein aplca Aplysia californica (California sea hare) California sea hare MLVSVYLALLVACVGQAHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERRAGNGFFRNLFD DIP protein Q8WSF8 original sequence version: 59 DIP protein Q8WSF8 original sequence version: 69 DIP protein Q8WSF8 original sequence version: 24 DIP protein Q8WSF8 original sequence version: 30 DIP protein Q8WSF8 original sequence version: 37 DIP protein Q8WSF8 original sequence version: 74 mint 6D0DE487C46707BE q8wsf8_aplca-1 4 7 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction achp_lymst-ca1a_conpe-1 1 5 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 6 unspecified role unspecified role unspecified role unspecified role in vitro In vitro direct interaction direct interaction ca1a_conpe-q8wsf8_aplca-1 3 7 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 6 unspecified role unspecified role unspecified role unspecified role P50984:p.[Ala10Leu;Asp14Lys] A10L/D14K mutation mutation certain certain sequence position certain certain certain sequence position certain D K certain certain sequence position certain certain certain sequence position certain A L This feature has been corrected as a result of our quality control procedures. The original label was 'A10L/D14K'. Wed May 02 16:37:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala10leu,asp14lys' Tue Jun 30 17:02:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala10Leu;Asp14Lys]' in vitro In vitro direct interaction direct interaction ca1a_conpe-q8wsf8_aplca-2 2 7 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 6 unspecified role unspecified role unspecified role unspecified role in vitro In vitro direct interaction direct interaction