DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Structure (London, England : 1993) 2005 imex curation Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132787X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Structure (London, England : 1993) 2005 imex curation Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132785X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Structure (London, England : 1993) 2005 imex curation Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132782X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Structure (London, England : 1993) 2005 imex curation Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132780X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Structure (London, England : 1993) 2005 imex curation Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132778X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Structure (London, England : 1993) 2005 imex curation Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132783X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Structure (London, England : 1993) 2005 imex curation Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132777X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Structure (London, England : 1993) 2005 imex curation Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132779X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Structure (London, England : 1993) 2005 imex curation Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132788X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Structure (London, England : 1993) 2005 imex curation Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132784X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Structure (London, England : 1993) 2005 imex curation Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132781X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Structure (London, England : 1993) 2005 imex curation Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132786X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. p14678-2 Small nuclear ribonucleoprotein-associated proteins B and B' SNRPB COD SNRPB1 Sm protein B/B' protein protein human Homo sapiens Human MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGLL DIP protein P14678-2 original sequence version: 127 DIP protein P14678-2 original sequence version: 136 5CB0BB2E75B93D4A ruxg_human Small nuclear ribonucleoprotein G SNRPG PBSCG Sm protein G protein protein human Homo sapiens Human MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV DIP protein P62308 original sequence version: 69 DIP protein P62308 original sequence version: 92 DIP protein P62308 original sequence version: 78 DIP protein P62308 original sequence version: 126 623302BF6BE758FE gemi7_human Gem-associated protein 7 SIP3 GEMIN7 protein protein human Homo sapiens Human MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP DIP protein Q9H840 original sequence version: 73 6E118922AFDCF567 smd2_human Small nuclear ribonucleoprotein Sm D2 SNRPD2 snRNP core protein D2 SNRPD1 protein protein human Homo sapiens Human MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK DIP protein P62316 original sequence version: 74 DIP protein P62316 original sequence version: 97 DIP protein P62316 original sequence version: 83 DIP protein P62316 original sequence version: 134 D986059D82B7E045 gemi6_human Gem-associated protein 6 SIP2 GEMIN6 protein protein human Homo sapiens Human MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYGPENCSSSNEIILSRVQDLIEGHLTASQ DIP protein Q8WXD5 original sequence version: 79 908EEFDA73A0C07F ruxf_human Small nuclear ribonucleoprotein F SNRPF PBSCF Sm protein F protein protein human Homo sapiens Human MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE DIP protein P62306 original sequence version: 64 DIP protein P62306 original sequence version: 84 DIP protein P62306 original sequence version: 73 DIP protein P62306 original sequence version: 120 416B88D575DAE58A ruxe_human Small nuclear ribonucleoprotein E SNRPE Sm protein E protein protein human Homo sapiens Human MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN DIP protein P62304 original sequence version: 64 DIP protein P62304 original sequence version: 87 DIP protein P62304 original sequence version: 73 DIP protein P62304 original sequence version: 123 7D8881CE1F4FA2FD smd1_human Small nuclear ribonucleoprotein Sm D1 SNRPD1 snRNP core protein D1 Sm-D autoantigen protein protein human Homo sapiens Human MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR DIP protein P62314 original sequence version: 77 DIP protein P62314 original sequence version: 100 DIP protein P62314 original sequence version: 86 DIP protein P62314 original sequence version: 135 0C81C94BF98E0810 smd3_human Small nuclear ribonucleoprotein Sm D3 SNRPD3 snRNP core protein D3 protein protein human Homo sapiens Human MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR DIP protein P62318 original sequence version: 72 DIP protein P62318 original sequence version: 95 DIP protein P62318 original sequence version: 81 DIP protein P62318 original sequence version: 102 DIP protein P62318 original sequence version: 131 59A6E78E860AA3E0 gemin6-gemin7-8 8 15 unspecified role unspecified role unspecified role unspecified role Gemin6 binding domain Region 31-131 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction gemin6-gemin7-9 7 15 unspecified role unspecified role prey prey Gemin6 binding domain Region 31-131 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association gemin6-snrpg-1 9 14 unspecified role unspecified role prey prey in vitro In vitro 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction gemin6-snrpd1-1 3 20 unspecified role unspecified role prey prey in vitro In vitro 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction gemin6-snrpd3-1 10 21 unspecified role unspecified role prey prey in vitro In vitro 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction gemin6-snrpe-1 12 19 unspecified role unspecified role prey prey in vitro In vitro 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction gemin6-gemin7-10 4 15 unspecified role unspecified role unspecified role unspecified role Gemin6 binding domain Region 31-131 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction gemin6-gemin7-11 5 15 unspecified role unspecified role unspecified role unspecified role Gemin6 binding domain Region 31-131 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction gemin6-snrpd2-1 6 16 unspecified role unspecified role prey prey in vitro In vitro 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction gemin6-snrpd1-2 11 20 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association gemin6-snrpf-1 1 18 unspecified role unspecified role prey prey in vitro In vitro 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction gemin6-snrpb-1 2 13 unspecified role unspecified role prey prey in vitro In vitro 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction