DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Structure (London, England : 1993) 2005 imex curation Yoon SI., Jones BC., Logsdon NJ., Walter MR. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yoon SI., Jones BC., Logsdon NJ., Walter MR. DIP original experiment: DIP-132747X Structure (London, England : 1993) 2005 IMEx Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Structure (London, England : 1993) 2005 imex curation Yoon SI., Jones BC., Logsdon NJ., Walter MR. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Yoon SI., Jones BC., Logsdon NJ., Walter MR. DIP original experiment: DIP-132749X Structure (London, England : 1993) 2005 IMEx Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Structure (London, England : 1993) 2005 imex curation Yoon SI., Jones BC., Logsdon NJ., Walter MR. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Yoon SI., Jones BC., Logsdon NJ., Walter MR. DIP original experiment: DIP-132750X Structure (London, England : 1993) 2005 IMEx Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Structure (London, England : 1993) 2005 imex curation Yoon SI., Jones BC., Logsdon NJ., Walter MR. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Yoon SI., Jones BC., Logsdon NJ., Walter MR. DIP original experiment: DIP-132748X Structure (London, England : 1993) 2005 IMEx Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Structure (London, England : 1993) 2005 imex curation Yoon SI., Jones BC., Logsdon NJ., Walter MR. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Yoon SI., Jones BC., Logsdon NJ., Walter MR. DIP original experiment: DIP-132751X Structure (London, England : 1993) 2005 IMEx Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Structure (London, England : 1993) 2005 imex curation Yoon SI., Jones BC., Logsdon NJ., Walter MR. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yoon SI., Jones BC., Logsdon NJ., Walter MR. DIP original experiment: DIP-132746X Structure (London, England : 1993) 2005 IMEx Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Structure (London, England : 1993) 2005 imex curation Yoon SI., Jones BC., Logsdon NJ., Walter MR. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Yoon SI., Jones BC., Logsdon NJ., Walter MR. DIP original experiment: DIP-132752X Structure (London, England : 1993) 2005 IMEx Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. il10_human Interleukin-10 IL10 Cytokine synthesis inhibitory factor protein protein human Homo sapiens Human MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN DIP protein P22301 original sequence version: 115 6825E9FA4337CDE4 il10h_hcmva Viral interleukin-10 homolog UL111A protein protein hcmva Human cytomegalovirus (strain AD169) (HHV-5) Human herpesvirus 5 HHV-5 MLSVMVSSSLVLIVFFLGASEEAKPATTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK This is the only entry of this protein in UniProt. DIP protein P17150 original sequence version: 58 2C3545486AC4A811 il10h_ebvb9 Viral interleukin-10 homolog BCRF1 20 kDa protein Protein BCRF1 protein protein ebvb9 Epstein-Barr virus (strain B95-8) (HHV-4) Human herpesvirus 4 HHV-4 MERRLVVTLQCLVLLYLAPECGGTDQCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTIKAR The protein was mapped to this strain from the sequence provided in the paper. DIP protein P03180 original sequence version: 81 AE20AE65D358F0CE i10r1_human Interleukin-10 receptor subunit alpha IL10RA IL10R Interleukin-10 receptor subunit 1 CDw210a protein protein human Homo sapiens Human MLPCLVVLLAALLSLRLGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVDEVTLTVGSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTFTHKKVKHENFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECISLTRQYFTVTNVIIFFAFVLLLSGALAYCLALQLYVRRRKKLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNREPPVLGDSCSSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGSALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRCLVDEAGLHPPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWSFAHDLAPLGCVAAPGGLLGSFNSDLVTLPLISSLQSSE DIP protein Q13651 original sequence version: 94 DIP protein Q13651 original sequence version: 93 54B183ABE84808DB il10h_ebvb9-il10ra-1 6 11 unspecified role unspecified role unspecified role unspecified role drome Drosophila melanogaster (Fruit fly) Fruit fly 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction il10-il10ra-5 2 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction ul111a-il10ra-1 7 9 unspecified role unspecified role bait bait ecolx Escherichia coli 11 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction il10h_ebvb9-il10ra-2 1 11 unspecified role unspecified role unspecified role unspecified role drome Drosophila melanogaster (Fruit fly) Fruit fly 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction il10h_ebvb9-il10ra-3 3 11 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 10 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction il10h_ebvb9-il10ra-4 4 11 unspecified role unspecified role unspecified role unspecified role drome Drosophila melanogaster (Fruit fly) Fruit fly 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction il10-il10ra-6 5 8 unspecified role unspecified role bait bait ecolx Escherichia coli 11 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction