DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu dUTPase as a platform for antimalarial drug design: structural basis for the selectivity of a class of nucleoside inhibitors. dUTPase as a platform for antimalarial drug design: structural basis for the selectivity of a class of nucleoside inhibitors. Structure (London, England : 1993) 2005 imex curation Whittingham JL., Leal I., Nguyen C., Kasinathan G., Bell E., Jones AF., Berry C., Benito A., Turkenburg JP., Dodson EJ., Ruiz Perez LM., Wilkinson AJ., Johansson NG., Brun R., Gilbert IH., Gonzalez Pacanowska D., Wilson KS. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Whittingham JL., Leal I., Nguyen C., Kasinathan G., Bell E., Jones AF., Berry C., Benito A., Turkenburg JP., Dodson EJ., Ruiz Perez LM., Wilkinson AJ., Johansson NG., Brun R., Gilbert IH., Gonzalez Pacanowska D., Wilson KS. DIP original experiment: DIP-132743X Structure (London, England : 1993) 2005 IMEx dUTPase as a platform for antimalarial drug design: structural basis for the selectivity of a class of nucleoside inhibitors. dUTPase as a platform for antimalarial drug design: structural basis for the selectivity of a class of nucleoside inhibitors. dUTPase as a platform for antimalarial drug design: structural basis for the selectivity of a class of nucleoside inhibitors. Structure (London, England : 1993) 2005 imex curation Whittingham JL., Leal I., Nguyen C., Kasinathan G., Bell E., Jones AF., Berry C., Benito A., Turkenburg JP., Dodson EJ., Ruiz Perez LM., Wilkinson AJ., Johansson NG., Brun R., Gilbert IH., Gonzalez Pacanowska D., Wilson KS. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Whittingham JL., Leal I., Nguyen C., Kasinathan G., Bell E., Jones AF., Berry C., Benito A., Turkenburg JP., Dodson EJ., Ruiz Perez LM., Wilkinson AJ., Johansson NG., Brun R., Gilbert IH., Gonzalez Pacanowska D., Wilson KS. DIP original experiment: DIP-132742X Structure (London, England : 1993) 2005 IMEx dUTPase as a platform for antimalarial drug design: structural basis for the selectivity of a class of nucleoside inhibitors. q8ii92_plaf7 Deoxyuridine 5'-triphosphate nucleotidohydrolase dUTP pyrophosphatase PF3D7_1127100 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MHLKIVCLSDEVREMYKNHKTHHEGDSGLDLFIVKDEVLKPKSTTFVKLGIKAIALQYKSNYYYKCEKSENKKKDDDKSNIVNTSFLLFPRSSISKTPLRLANSIGLIDAGYRGEIIAALDNTSDQEYHIKKNDKLVQLVSFTGEPLSFELVEELDETSRGEGGFGSTSNNKY DIP protein Q8II92 original sequence version: 43 q8ii92_plaf7-1 2 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction q8ii92_plaf7-2 1 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction