DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The X-ray structure of RANTES: heparin-derived disaccharides allows the rational design of chemokine inhibitors. The X-ray structure of RANTES: heparin-derived disaccharides allows the rational design of chemokine inhibitors. Structure (London, England : 1993) 2004 imex curation Shaw JP., Johnson Z., Borlat F., Zwahlen C., Kungl A., Roulin K., Harrenga A., Wells TN., Proudfoot AE. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shaw JP., Johnson Z., Borlat F., Zwahlen C., Kungl A., Roulin K., Harrenga A., Wells TN., Proudfoot AE. DIP original experiment: DIP-132907X Structure (London, England : 1993) 2004 IMEx The X-ray structure of RANTES: heparin-derived disaccharides allows the rational design of chemokine inhibitors. ccl5_human C-C motif chemokine 5 CCL5 D17S136E SCYA5 EoCP Eosinophil chemotactic cytokine SIS-delta Small-inducible cytokine A5 T cell-specific protein P228 T-cell-specific protein RANTES protein protein human Homo sapiens Human MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS DIP protein P13501 original sequence version: 123 DIP protein P13501 original sequence version: 133 DIP protein P13501 original sequence version: 170 FB0BFAF9A87C620F ccl5-6 1 2 unspecified role unspecified role unspecified role unspecified role Region 24-91 Region 24-91 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction