UniProt UniProt http://www.uniprot.org The in vivo activity of Ime1, the key transcriptional activator of meiosis-specific genes in Saccharomyces cerevisiae, is inhibited by the cyclic AMP/protein kinase A signal pathway through the glycogen synthase kinase 3-beta homolog Rim11. The in vivo activity of Ime1, the key transcriptional activator of meiosis-specific genes in Saccharomyces cerevisiae, is inhibited by the cyclic AMP/protein kinase A signal pathway through the glycogen synthase kinase 3-beta homolog Rim11. Molecular and cellular biology 2004 imex curation Rubin-Bejerano I., Sagee S., Friedman O., Pnueli L., Kassir Y. ykassir@techunix.technion.ac.il 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rubin-Bejerano I., Sagee S., Friedman O., Pnueli L., Kassir Y. ykassir@techunix.technion.ac.il Accepted 2017-NOV-27 AT 14:50 GMT AT 14:50 GMT by MGT Molecular and cellular biology 2004 imex curation ume6_yeast Transcriptional regulatory protein UME6 UME6 CAR80 CARGR1 YDR207C YD8142.04C Unscheduled meiotic gene expression protein 6 Negative transcriptional regulator of IME2 Regulator of inducer of meiosis protein 16 NIM2 RIM16 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLDKARSQSKHMDESNAAASLLSMETTANNHHYLHNKTSRATLMNSSQDGKKHAEDEVSDGANSRHPTISSASIESLKTTYDENPLLSIMKSTCAPNNTPVHTPSGSPSLKVQSGGDIKDDPKENDTTTTTNTTLQDRRDSDNAVHAAASPLAPSNTPSDPKSLCNGHVAQATDPQISGAIQPQYTATNEDVFPYSSTSTNSNTATTTIVAGAKKKIHLPPPQAPAVSSPGTTAAGSGAGTGSGIRSRTGSDLPLIITSANKNNGKTTNSPMSILSRNNSTNNNDNNSIQSSDSRESSNNNEIGGYLRGGTKRGGSPSNDSQVQHNVHDDQCAVGVAPRNFYFNKDREITDPNVKLDENESKINISFWLNSKYRDEAYSLNESSSNNASSNTDTPTNSRHANTSSSITSRNNFQHFRFNQIPSQPPTSASSFTSTNNNNPQRNNINRGEDPFATSSRPSTGFFYGDLPNRNNRNSPFHTNEQYIPPPPPKYINSKLDGLRSRLLLGPNSASSSTKLDDDLGTAAAVLSNMRSSPYRTHDKPISNVNDMNNTNALGVPASRPHSSSFPSKGVLRPILLRIHNSEQQPIFESNNSTAVFDEDQDQNQDLSPYHLNLNSKKVLDPTFESRTRQVTWNKNGKRIDRRLSAPEQQQQLEVPPLKKSRRSVGNARVASQTNSDYNSLGESSTSSAPSSPSLKASSGLAYTADYPNATSPDFAKSKGKNVKPKAKSKAKQSSKKRPNNTTSKSKANNSQESNNATSSTSQGTRSRTGCWICRLRKKKCTEERPHCFNCERLKLDCHYDAFKPDFVSDPKKKQMKLEEIKKKTKEAKRRAMKKK 0DDA0A6B4A157182 0DDA0A6B4A157182 ime1_yeast Meiosis-inducing protein 1 IME1 J1916 YJR094C protein protein yeast Saccharomyces cerevisiae Baker's yeast MQADMHGKLHAALEDGFFLFPFEQQQQPNIYYDTTTDQEDRPCFSFGSTISPRSWHFEKSDKIASSQLQNLVHTQPIHLINPQILFNEEFLNLENIDSQPISKETKTTKDCTMATGPERGKKSSESTRSSSLSSLFSNDESASTFHSSFNNHDNFQKSNRNGDDIDISDTIKYETNTNAQKDIKIFQENFEFNEFPYTQDFYPYTTNYTYSKPTNIHESINSKNTDSYSQYQDQFPPHTDNIHSFNNRHYSNHKSTNCNYYNNTSNNNNASDNVYEADPFIDEPQVPSYYYPLEIAFDVEKSPPPSLQKLNSKELEFLKKLNSKLSRYAAAYSFSSSNDQDYYDKVRFQEISYKFSKTYS 98E21C22926F5A80 ime1-ume6-1 1 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P21190:p.Tyr359Phe mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 17:56:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr359phe' Tue Jun 30 17:08:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr359Phe' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P21190:p.Ser302Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S D Wed May 02 20:23:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser302asp' Tue Jun 30 20:24:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser302Asp' P21190:p.Ser302Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Wed May 02 14:28:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser302ala' Tue Jun 30 18:43:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser302Ala' P21190:p.Ser306Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:47:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser306ala' Tue Jun 30 18:26:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser306Ala' P21190:p.Ser333Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:09:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser333ala' Tue Jun 30 17:46:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser333Ala' P21190:p.Ser337Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:07:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser337ala' Tue Jun 30 17:54:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser337Ala' P21190:p.[Ser352Ala;Ser356Ala;Ser360Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 20:05:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser352ala,ser356ala,ser360ala' Tue Jun 30 18:16:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser352Ala;Ser356Ala;Ser360Ala]' 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 15 7 physical association physical association We therefore used this two-hybrid assay to determine whether mutations in the putative Rim11 phosphorylation sites will impair the interaction of Ime1 with Ume6. Fig. 7 Interaction was not observed in RIM11-/- cells