UniProt UniProt http://www.uniprot.org Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method Characterization of the products of the genes SNO1 and SNZ1 involved in pyridoxine synthesis in Saccharomyces cerevisiae. Characterization of the products of the genes SNO1 and SNZ1 involved in pyridoxine synthesis in Saccharomyces cerevisiae. European journal of biochemistry 2004 imex curation Dong YX., Sueda S., Nikawa J., Kondo H. kondo@bse.kyutech.ac.jp 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Dong YX., Sueda S., Nikawa J., Kondo H. kondo@bse.kyutech.ac.jp Accepted 2018-JUN-25 AT 14:07 BST AT 14:07 BST by PPORRAS European journal of biochemistry 2004 Only protein-protein interactions imex curation imex curation Characterization of the products of the genes SNO1 and SNZ1 involved in pyridoxine synthesis in Saccharomyces cerevisiae. Characterization of the products of the genes SNO1 and SNZ1 involved in pyridoxine synthesis in Saccharomyces cerevisiae. European journal of biochemistry 2004 imex curation Dong YX., Sueda S., Nikawa J., Kondo H. kondo@bse.kyutech.ac.jp 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro cleavage cleavage assay cleavage predetermined predetermined participant predetermined Dong YX., Sueda S., Nikawa J., Kondo H. kondo@bse.kyutech.ac.jp Accepted 2018-JUN-25 AT 14:07 BST AT 14:07 BST by PPORRAS European journal of biochemistry 2004 Only protein-protein interactions imex curation imex curation 6-diazo-5-oxo-l-norleucine 6-diazo-5-oxo-l-norleucine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) sno1_yeast Pyridoxal 5'-phosphate synthase subunit SNO1 SNO1 PDX2 homolog 1 Pyridoxal 5'-phosphate synthase glutaminase subunit YM6543.02C YMR095C protein protein yeast Saccharomyces cerevisiae Baker's yeast MHKTHSTMSGKSMKVIGVLALQGAFLEHTNHLKRCLAENDYGIKIEIKTVKTPEDLAQCDALIIPGGESTSMSLIAQRTGLYPCLYEFVHNPEKVVWGTCAGLIFLSAQLENESALVKTLGVLKVDVRRNAFGRQAQSFTQKCDFSNFIPGCDNFPATFIRAPVIERILDPIAVKSLYELPVNGKDVVVAATQNHNILVTSFHPELADSDTRFHDWFIRQFVSN C0EC1B2382581D40 snz1_yeast Pyridoxal 5'-phosphate synthase subunit SNZ1 SNZ1 PDX1 homolog 1 YM6543.03 YMR096W p35 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTGEDFKIKSGLAQMLKGGVIMDVVTPEQAKIAEKSGACAVMALESIPADMRKSGKVCRMSDPKMIKDIMNSVSIPVMAKVRIGHFVEAQIIEALEVDYIDESEVLTPADWTHHIEKDKFKVPFVCGAKDLGEALRRINEGAAMIRTKGEAGTGDVSEAVKHIRRITEEIKACQQLKSEDDIAKVAEEMRVPVSLLKDVLEKGKLPVVNFAAGGVATPADAALLMQLGCDGVFVGSGIFKSSNPVRLATAVVEATTHFDNPSKLLEVSSDLGELMGGVSIESISHASNGVRLSEIGW C5BC77711B415D9F l-glutamine L-glutamine (2S)-2,5-diamino-5-oxopentanoic acid (2S)-2-amino-4-carbamoylbutanoic acid (S)-2,5-diamino-5-oxopentanoic acid Glutamic acid 5-amide Glutamic acid amide GLUTAMINE L-(+)-glutamine L-2-Aminoglutaramic acid L-2-aminoglutaramic acid L-glutamic acid gamma-amide L-Glutamin L-Glutamine L-Glutaminsaeure-5-amid Levoglutamide Q L-glutamine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ZDXPYRJPNDTMRX-VKHMYHEASA-N ZDXPYRJPNDTMRX-VKHMYHEASA-N sno1-snz1-1 2 6 unspecified role unspecified role prey prey purified purified 5 unspecified role unspecified role bait bait purified purified n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction Fig. 3 When Sno1p with a His-tag and Snz1p without a tag were coexpressed and then applied to a His-Bind affinity column, not only Sno1p but also Snz1p bound to the column and was eluted simultaneously by imidazole, strongly suggesting that they form a complex. l_glutamine-sno1_snz1_yeast-1 3 7 enzyme target enzyme target substrate substrate unspecified role unspecified role 16 enzyme enzyme unspecified role unspecified role q03144 c-terminal his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) cleavage cleavage reaction cleavage Figs 4,5, 6 l_glutamine-sno1_snz1_yeast-2 3 4 inhibitor inhibitor unspecified role unspecified role 7 enzyme target enzyme target substrate substrate unspecified role unspecified role 16 enzyme enzyme unspecified role unspecified role q03144 c-terminal his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) cleavage cleavage reaction cleavage Figs 6 sno1-snz1_yeast SNO1-SNZ1 pyridoxal 5'-phosphate synthase complex SNO1:SNZ1 6 enzyme enzyme sno1 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 enzyme enzyme snz1 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 24 26 direct interaction direct interaction yeast Saccharomyces cerevisiae Baker's yeast stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction Catalyzes the hydrolysis of glutamine to glutamate and ammonia, thus supplying ammonia as a source of the ring nitrogen of pyridoxine as part of the biosynthesis of pyridoxal 5'-phosphate. SNZ1 may act as a synthetase that mediates the coupling of ammonia with an unknown acceptor substrate, possibly via a tunnel in the synthetase subunit. Accepted 2017-DEC-14 by LIVIAP