IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Calcineurin, a calcium/calmodulin-dependent protein phosphatase, is involved in movement, fertility, egg laying, and growth in Caenorhabditis elegans. Calcineurin, a calcium/calmodulin-dependent protein phosphatase, is involved in movement, fertility, egg laying, and growth in Caenorhabditis elegans. Molecular biology of the cell 2002 imex curation Bandyopadhyay J., Lee J., Lee J., Lee JI., Yu JR., Jee C., Cho JH., Jung S., Lee MH., Zannoni S., Singson A., Kim DH., Koo HS., Ahnn J. Phosphatase assays not added as I could find no details of the substrate. joohong@kjist.ac.kr 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bandyopadhyay J., Lee J., Lee J., Lee JI., Yu JR., Jee C., Cho JH., Jung S., Lee MH., Zannoni S., Singson A., Kim DH., Koo HS., Ahnn J. Phosphatase assays not added as I could find no details of the substrate. joohong@kjist.ac.kr Accepted 2017-JUN-07 AT 08:15 BST AT 08:15 BST by MGT Molecular biology of the cell 2002 imex curation Calcineurin, a calcium/calmodulin-dependent protein phosphatase, is involved in movement, fertility, egg laying, and growth in Caenorhabditis elegans. Calcineurin, a calcium/calmodulin-dependent protein phosphatase, is involved in movement, fertility, egg laying, and growth in Caenorhabditis elegans. Molecular biology of the cell 2002 imex curation Bandyopadhyay J., Lee J., Lee J., Lee JI., Yu JR., Jee C., Cho JH., Jung S., Lee MH., Zannoni S., Singson A., Kim DH., Koo HS., Ahnn J. Phosphatase assays not added as I could find no details of the substrate. joohong@kjist.ac.kr 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Bandyopadhyay J., Lee J., Lee J., Lee JI., Yu JR., Jee C., Cho JH., Jung S., Lee MH., Zannoni S., Singson A., Kim DH., Koo HS., Ahnn J. Phosphatase assays not added as I could find no details of the substrate. joohong@kjist.ac.kr Accepted 2017-JUN-07 AT 08:15 BST AT 08:15 BST by MGT Molecular biology of the cell 2002 imex curation q20203_caeel Calsequestrin csq-1 CELE_F40E10.3 F40E10.3 protein protein caeel Caenorhabditis elegans MTWIKLASLALVVVLASAGISKNEDLECMFLGYPDLEYDGFDRTEVLTEKNFNRTVFAEDTKSVVFFNDVEEDDSELDQYECFLQLSAQIMTKRGYNFYTVNTTKEHRLRKQEEVEKGEDTIHVYKDGYKIEYNGVRDPETFVSWLMDIPDDPVTIINDEHDLEEFENMDDECVRIIGYFEPGSVALKEFEEAAEDFMGEIEFFAVVTSKWARKVGLKRVGEVQMRRPFEEDPLFAPTSADTEEEFEDWVEKNKEPVMQKLTLDNYFNLWRDPEEEERMILAFVDEETREGRAMKRLLDKIADENSEHAGTLEIILVDPDEFPLMVDVWEDMFGIDIEEGPQIGLIDISEKEGIWFDMSQVNLDDPKKHSDSNFEALQSWIDQILSGSISLDDDDDDEPEPPAPPPTPKGKKSRKEL 02B52D4CDBC92BA1 pp2b_caeel Serine/threonine-protein phosphatase 2B catalytic subunit tax-6 Abnormal chemotaxis protein 6 Calmodulin-dependent calcineurin subunit A cna-1 C02F4.2 protein protein caeel Caenorhabditis elegans MASTSAGQNSAAKPDTTNTTTTASNNNRERERDLKQFTERFVKTVQFPVSERLTVDQVYDRRTGKPRHEVLRDHFIKEGRIEEEAAIRVIQECSSLFRNEKTMLEIEAPVTVCGDIHGQFYDLMKLFEVGGSPATTKYLFLGDYVDRGYFSIECVLYLWALKICYPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDVCMESFDALPLAALMNQQFLCVHGGLSPEIHTLEDIRRIDRFKEPPAFGPMCDLLWSDPLEDFGNERNSEQFSHNSVRGCSYFYSYAACCDFLQHNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAILKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVHILNICSDDELMAECDDTFEGGVGSARKEVIRHKIRAIGKMARAFSVLRHESESVLQLKGLNAGGKLPQGALSEGRTGLNAAYRIEQSVAAESGCDSGHLIQSFEEARRLDKINERMPPTMATPPAQSPSQSPIPSRQTTPQPPQNGPSNS 60983B8A0C504883 calcium(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) canb_caeel Protein phosphatase 2B regulatory subunit cnb-1 Calcineurin subunit B F55C10.1 cnb-1 protein protein caeel Caenorhabditis elegans MGADASLPMEMCSNFDAYELRRLTRRFKKLDVDGSGSLSVEEFMSLPELQQNPLVQRVIDIFDEDGNGEVDFREFIQGISQFSVKGDKNTKLKFAFRIYDMDRDGFISNGELFQVLKMMVGNNLKDSQLQQIVDKTILFHDKDGDGKISFQEFCDVVEHTEVHKKMVLENI 6AB68B3B4A613060 cnb_1-calcium(2+)-1 2 5 unspecified role unspecified role bait bait 45ca region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2A Recombinant GST-CNB-1 had strong Ca2+-binding activity (Figure ​(Figure2A,2A, lane 4) csq_1-calcium(2+)-1 2 5 unspecified role unspecified role bait bait 45ca region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2A cnb_1-tax_6-1 1 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Fig. 2B We utilized the yeast two-hybrid system to check if CNA-1 interacted with CNB-1.