DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex. Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex. Nature 2002 imex curation Zheng N., Schulman BA., Song L., Miller JJ., Jeffrey PD., Wang P., Chu C., Koepp DM., Elledge SJ., Pagano M., Conaway RC., Conaway JW., Harper JW., Pavletich NP. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zheng N., Schulman BA., Song L., Miller JJ., Jeffrey PD., Wang P., Chu C., Koepp DM., Elledge SJ., Pagano M., Conaway RC., Conaway JW., Harper JW., Pavletich NP. DIP original experiment: DIP-265082X Nature 2002 IMEx Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex. Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex. Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex. Nature 2002 imex curation Zheng N., Schulman BA., Song L., Miller JJ., Jeffrey PD., Wang P., Chu C., Koepp DM., Elledge SJ., Pagano M., Conaway RC., Conaway JW., Harper JW., Pavletich NP. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zheng N., Schulman BA., Song L., Miller JJ., Jeffrey PD., Wang P., Chu C., Koepp DM., Elledge SJ., Pagano M., Conaway RC., Conaway JW., Harper JW., Pavletich NP. DIP original experiment: DIP-265081X Nature 2002 IMEx Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex. Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex. Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex. Nature 2002 imex curation Zheng N., Schulman BA., Song L., Miller JJ., Jeffrey PD., Wang P., Chu C., Koepp DM., Elledge SJ., Pagano M., Conaway RC., Conaway JW., Harper JW., Pavletich NP. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Zheng N., Schulman BA., Song L., Miller JJ., Jeffrey PD., Wang P., Chu C., Koepp DM., Elledge SJ., Pagano M., Conaway RC., Conaway JW., Harper JW., Pavletich NP. DIP original experiment: DIP-265080X Nature 2002 IMEx Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex. Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex. Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex. Nature 2002 imex curation Zheng N., Schulman BA., Song L., Miller JJ., Jeffrey PD., Wang P., Chu C., Koepp DM., Elledge SJ., Pagano M., Conaway RC., Conaway JW., Harper JW., Pavletich NP. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Zheng N., Schulman BA., Song L., Miller JJ., Jeffrey PD., Wang P., Chu C., Koepp DM., Elledge SJ., Pagano M., Conaway RC., Conaway JW., Harper JW., Pavletich NP. DIP original experiment: DIP-265083X Nature 2002 IMEx Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex. Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex. Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex. Nature 2002 imex curation Zheng N., Schulman BA., Song L., Miller JJ., Jeffrey PD., Wang P., Chu C., Koepp DM., Elledge SJ., Pagano M., Conaway RC., Conaway JW., Harper JW., Pavletich NP. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zheng N., Schulman BA., Song L., Miller JJ., Jeffrey PD., Wang P., Chu C., Koepp DM., Elledge SJ., Pagano M., Conaway RC., Conaway JW., Harper JW., Pavletich NP. DIP original experiment: DIP-265079X Nature 2002 IMEx Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex. Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex. Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex. Nature 2002 imex curation Zheng N., Schulman BA., Song L., Miller JJ., Jeffrey PD., Wang P., Chu C., Koepp DM., Elledge SJ., Pagano M., Conaway RC., Conaway JW., Harper JW., Pavletich NP. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Zheng N., Schulman BA., Song L., Miller JJ., Jeffrey PD., Wang P., Chu C., Koepp DM., Elledge SJ., Pagano M., Conaway RC., Conaway JW., Harper JW., Pavletich NP. DIP original experiment: DIP-265078X Nature 2002 IMEx Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex. apc2_yeast Anaphase-promoting complex subunit 2 APC2 RSI1 YLR127C L3105 L3108 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFQITPTRDLKVITDELQTLSSYIFHTNIVDDLNSLLTWMSPNDAKSNHQLRPPSLRIKNIIKVLFPNNATTSPYSMINTSQANNSIVNEGNTNKELQLQLFSTLKEFYIFQVRYHFFLHFNNINYLKDIQRWENYYEFPLRYVPIFDVNVNDWALELNSLRHYLLNRNIKFKNNLRTRLDKLIMDDDFDLADNLIQWLKSANGSLSSTELIVNALYSKINKFCEDNMSRVWNKRFMIMETFNKFINQYWSQFSKLVGCPEDDHELTTTVFNCFESNFLRIRTNEIFDICVLAYPDSKVTLLELRKIMKDFKDYTNIVTTFLSDFKKYILNPSVTTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAMLDLPEEELKEKINFNVDMKALLSLVDTLHDSDINQDTNITKRDKNKKSPFLWNLKVKGKRELNKDLPIRHAMLYEHILNYYIAWVPEPNDMIPGNIKSSYIKTNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYTLDEKWTRCLKLIREKIVKFTETSHSNYITNGILGLLETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPIIFPKFISLLYWKYNCDTQGSNDLAFHLPIDLERELQKYSDIYSQLKPGRKLQLCKDKGKVEIQLAFKDGRKLVLDVSLEQCSVINQFDSPNDEPICLSLEQLSESLNIAPPRLTHLLDFWIQKGVLLKENGTYSVIEHSEMDFDQAQKTAPMEIENSNYELHNDSEIERKYELTLQRSLPFIEGMLTNLGAMKLHKIHSFLKITVPKDWGYNRITLQQLEGYLNTLADEGRLKYIANGSYEIVKNGHKNS E559A0E28C784DE2 E559A0E28C784DE2 rbx1_human E3 ubiquitin-protein ligase RBX1 RBX1 RNF75 ROC1 Regulator of cullins 1 RING finger protein 75 Protein ZYP RING-box protein 1 E3 ubiquitin-protein transferase RBX1 protein protein human Homo sapiens Human MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH DIP protein P62877 original sequence version: 120 DIP protein P62877 original sequence version: 115 DIP protein P62877 original sequence version: 78 DIP protein P62877 original sequence version: 113 DIP protein P62877 original sequence version: 75 DIP protein P62877 original sequence version: 86 DIP protein P62877 original sequence version: 136 DIP protein P62877 original sequence version: 126 DIP protein P62877 original sequence version: 90 DIP protein P62877 original sequence version: 114 30FC5ADF66096C0E p63208-1 S-phase kinase-associated protein 1 SKP1 EMC19 OCP2 SKP1A TCEB1L Cyclin-A/CDK2-associated protein p19 Organ of Corti protein 2 Organ of Corti protein II RNA polymerase II elongation factor-like protein SIII p19skp1 Transcription elongation factor B polypeptide 1-like protein protein human Homo sapiens Human MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK DIP protein P63208-1 original sequence version: 128 DIP protein P63208-1 original sequence version: 116 DIP protein P63208 original sequence version: 76 DIP protein P63208-1 original sequence version: 76 DIP protein P63208 original sequence version: 104 DIP protein P63208 original sequence version: 127 DIP protein P63208 original sequence version: 123 DIP protein P63208 original sequence version: 61 DIP protein P63208 original sequence version: 91 DIP protein P63208 original sequence version: 115 DIP protein P63208 original sequence version: 94 DIP protein P63208 original sequence version: 75 DIP protein P63208 original sequence version: 85 C794D62AFB75528A cdn1b_human Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 CDKN1B KIP1 protein protein human Homo sapiens Human MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT DIP protein P46527 original sequence version: 120 DIP protein P46527 original sequence version: 115 DIP protein P46527 original sequence version: 154 DIP protein P46527 original sequence version: 168 DIP protein P46527 original sequence version: 164 DIP protein P46527 original sequence version: 118 1118D58901CDF3FC q13309-1 S-phase kinase-associated protein 2 Cyclin-A/CDK2-associated protein p45 F-box protein Skp2 F-box/LRR-repeat protein 1 p45skp2 SKP2-alpha SKP2 FBXL1 protein protein human Homo sapiens Human MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL DIP protein Q13309-1 original sequence version: 154 DIP protein Q13309-1 original sequence version: 104 DIP protein Q13309 original sequence version: 105 DIP protein Q13309 original sequence version: 153 DIP protein Q13309 original sequence version: 151 cul1_human Cullin-1 CUL1 protein protein human Homo sapiens Human MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA DIP protein Q13616 original sequence version: 144 DIP protein Q13616 original sequence version: 133 DIP protein Q13616 original sequence version: null DIP protein Q13616 original sequence version: 135 DIP protein Q13616 original sequence version: 98 DIP protein Q13616 original sequence version: 110 DIP protein Q13616 original sequence version: 146 DIP protein Q13616 original sequence version: 148 DIP protein Q13616 original sequence version: 100 DIP protein Q13616 original sequence version: 85 DIP protein Q13616 original sequence version: 114 DIP protein Q13616 original sequence version: 119 DIP protein Q13616 original sequence version: 136 DIP protein Q13616 original sequence version: 117 DIP protein Q13616 original sequence version: 99 DIP protein Q13616 original sequence version: 108 6625A1FFA7799BBA cul1-rbx1-6 6 8 unspecified role unspecified role prey prey 19-108 Binding Region 19-108 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 12 unspecified role unspecified role bait bait GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17-776 Binding Region 17-776 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association cul1-rbx1-12 3 8 unspecified role unspecified role unspecified role unspecified role 19-108 BindingRegion 19-108 BindingRegion sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 12 unspecified role unspecified role unspecified role unspecified role 17-776 Binding Region 17-776 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association cul1-rbx1-13 5 8 unspecified role unspecified role unspecified role unspecified role 19-108 Binding Region 19-108 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 12 unspecified role unspecified role unspecified role unspecified role 17-776 Binding Region 17-776 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction apc2-1 1 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cul1-rbx1-14 2 11 unspecified role unspecified role unspecified role unspecified role 97-137 Binding Region 97-137 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role 2-140 Binding Region 2-140 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role 19-108 Binding Region 19-108 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role 15-776 Binding Region 15-776 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association cul1-cdkn1b-1 4 10 unspecified role unspecified role prey prey phospholylated residue(s) phospholylated residue(s) 32p radiolabel 32p radiolabel P32 32P 32P P32 predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phosphorylated residue phosphorylated residue phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 12 unspecified role unspecified role bait bait GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association