DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Heterodimeric structure of superoxide dismutase in complex with its metallochaperone. Heterodimeric structure of superoxide dismutase in complex with its metallochaperone. Nature structural biology 2001 imex curation Lamb AL., Torres AS., O'Halloran TV., Rosenzweig AC. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lamb AL., Torres AS., O'Halloran TV., Rosenzweig AC. DIP original experiment: DIP-262951X Nature structural biology 2001 IMEx Heterodimeric structure of superoxide dismutase in complex with its metallochaperone. sodc_yeast Superoxide dismutase [Cu-Zn] SOD1 J1968 YJR104C protein protein yeast Saccharomyces cerevisiae Baker's yeast MVQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN E263A74679AF11F7 E263A74679AF11F7 ccs1_yeast Superoxide dismutase 1 copper chaperone CCS1 LYS7 YMR038C YM9532.03C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTTNDTYEATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDAIIRGAGKPNSSAVAILETFQKYTIDQKKDTAVRGLARIVQVGENKTLFDITVNGVPEAGNYHASIHEKGDVSKGVESTGKVWHKFDEPIECFNESDLGKNLYSGKTFLSAPLPTWQLIGRSFVISKSLNHPENEPSSVKDYSFLGVIARSAGVWENNKQVCACTGKTVWEERKDALANNIK 81DB7E728CDF9366 81DB7E728CDF9366 sod1-yccs-1 1 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 2 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction