IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ dpl-1 DP and efl-1 E2F act with lin-35 Rb to antagonize Ras signaling in C. elegans vulval development. dpl-1 DP and efl-1 E2F act with lin-35 Rb to antagonize Ras signaling in C. elegans vulval development. Molecular cell 2001 imex curation Ceol CJ., Horvitz HR. horvitz@mit.edu 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ceol CJ., Horvitz HR. horvitz@mit.edu Accepted 2017-JUN-07 AT 08:41 BST AT 08:41 BST by MGT Molecular cell 2001 imex curation g5ef11_caeel efl-1 CELE_Y102A5C.18 Y102A5C.18 protein protein caeel Caenorhabditis elegans MEDSYNDMEDPGFRQLSDMELQKALEMTKQSSIKNNLMLGLDNELDFDFDFDEDEDLDQPQMGTRADKSLGLLAKRFIRMIQYSPYGRCDLNTAAEALNVRQKRRIYDITNVLEGIGLIEKRSKNMIQWKGGDFMLNVKEGKRQSATTEEEDRMEQLKAEIEQLNKEEELIEQRQRWLQQSLRNMTESVENNKLSYVLRSQLAEIQGSDLTIGIQTRVGTQVRLSDPEQVEIHGGPSWCYLKDPSGPLRAAIVSNHELHDFVQRERAKRPGEEHVDADAPDEMMDDSRYRNRRTINDDEMFGFEQKVPAMKHLEPPPASDDYVYSSTGDEYRGDSIVDLYGD A99C689826B72588 lin35_caeel Retinoblastoma-like protein homolog lin-35 lin-35 Abnormal cell lineage protein 35 Synthetic multivulva protein lin-35 C32F10.2 protein protein caeel Caenorhabditis elegans MPKRAADEPGTSTTDPFHEQSPFDAVLAGTETTDTICEEPPAKRIDLDIKQEFNGGVQSGGLIKNESELTQMTIKQETEGNINEARREEEDEEQDEDSRTSMPPALGEDDDYEEDDADSFIDKTNTPPPSQSFLEGCRAANLPNDIVTGAWETYNHAVQRVSLEGSESAWQLSAIYYYLLSKGIKRRGKTIRILIQPFPVSILTIANSFDISVAEMLDKTARFVEIIHSRKIRRYQEYIRRIQEGLAVSCVIFKKFCRIFCKIFEEIKVGSENCPSSHELFTVLWTSFLVMKSRMTVDDLISNYQLLFSILDQVYTEMCSMKEGIVHHLNQKFVEDLLENDCTIIRALCTQFGGSVLDARHFSDHTFKKMEKTGIPSTWNFQEFRDLIMNVPKTAYENYLLQRGSIDERIFIPSVEDFSKIFQSPDTYSVADILKVSYSGRRFRDAEFLTKISNNHCLEKLALGGKVASEKLVTQSKEQPRVPCVEYNLELGNYPDDLESNNQSLYNRLTKIIGSWKLENSKLEEVCGTMSDSPMATILLKSDEMTNKFERTLSAELGETINENIPKYHYNVRKELELVFLIFMEKIIVAELKKKVREEDLLNVIRREEFLDSVFCFCVELILVSNGYDRPFPWSAELCGVHPFMFHKVIDLMITHEKQLSRQMVQHFSRIEETVIEYFSWKSDSPLWPMVVRCPFAHFQEFGEDWADKLNSYSPIKFTPIKKPDDLRDELGRPIVPQNQTSRTLRIFLKRTYFTAARRLQDLTDRVSMGARAKSQCWSLFDYLLRNDTLIFMDRHLDQILLCCVFVIMKINESSMLFTEIMAQYRRQSANSLLVYRSVTVFQEQLNPENPQAVNTKETILERLEGPQKEKTTVDIIKYYNIEFRDRIKYIIGQIDSASDEDLMEMPVATESGLMPVRVYLTHKLSIQTLPKTKHGESKQERAIANLEKSGITIAMERSGD DIP protein G5EDT1 original sequence version: 31 712475505E527DF1 tfdp1_caeel Transcription factor dpl-1 dpl-1 T23G7.1 protein protein caeel Caenorhabditis elegans MNPTNYDPRIGQPAQSRPQVSLSMGRRIVQMPTGLPRSYQDESHNEPVGWDEPSGVGGSSGAGGQQSDKPTGLRHFSTKVCEKVKEKGLTNYNEVADELVADYFQNNLIKQIDVVKQEYDMKNIRRRVYDALNVLLAMNIITKSKKDIRWIGLPASASQEISRLEEEKSRREASISSKKQALEEMVLQIVSYKNLVERNRKNEHKNGRPENDTVLHLPFLIINTDKEANVECSVSSDKSEFLFSFDKKFEIHDDFEILKKLNLACSLETTNPTAEEVKTAKSFLPTLHQHYVDEIIANRKKVEAEKEEKRKQQQLIADQMSMNLSQAQYVEPTSSLAQMSYSSRFNRQLQEHLINDGSEDRSAAAGIMERDYDMDKNVNQGSASRGPMYNTYSPQKIRAQVNTPLQVPPVTKRYYVQKTQGPMKHDMTPVVRTVNRPYSTVPPDRRLSTGATSVNSGPVKYYVPQGHQPMHQPVGQRYRVRPQQPQMSHMGQPHQVQQRVVYPAGSISGHQLQPGQRIVTQRIVAPGGPHPPGTIVRKVIRKIVVNNPKQSPAQQVIQKKMMEQDMCTFERKTEQPMTSAQAAALIQHPQPEEYDYFQ DIP protein Q22703 original sequence version: 104 A79692087FF3D2AE dpl_1-efl_1-1 1 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 5A We found that GST-tagged DPL-1(31–343) but not GST-DPL-1(344–598) bound in vitro–translated EFL-1 (Figure 5A). dpl_1-lin_35-1 1 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 13 17 direct interaction direct interaction Fig. 5A However, GST-DPL-1(344–598) specifically bound the LIN-35(270–961) fragment (Figure 5A), efl_1-lin_35-1 1 2 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Fig. 5B GST-EFL-1(214–342) interacted in vitro with LIN-35(270–961) (Figure 5B). dpl_1-efl_1-2 1 3 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 5C When incubated in a single binding reaction, both EFL-1 and LIN-35(270–961) associated with GST-DPL-1(31–343) (Figure 5C).