DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis of IAP recognition by Smac/DIABLO. Structural basis of IAP recognition by Smac/DIABLO. Nature 1999 imex curation Wu G., Chai J., Suber TL., Wu JW., Du C., Wang X., Shi Y. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wu G., Chai J., Suber TL., Wu JW., Du C., Wang X., Shi Y. DIP original experiment: DIP-265105X Nature 1999 IMEx Structural basis of IAP recognition by Smac/DIABLO. Structural basis of IAP recognition by Smac/DIABLO. Structural basis of IAP recognition by Smac/DIABLO. Nature 1999 imex curation Wu G., Chai J., Suber TL., Wu JW., Du C., Wang X., Shi Y. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wu G., Chai J., Suber TL., Wu JW., Du C., Wang X., Shi Y. DIP original experiment: DIP-265104X Nature 1999 IMEx Structural basis of IAP recognition by Smac/DIABLO. xiap_human E3 ubiquitin-protein ligase XIAP Inhibitor of apoptosis protein 3 X-linked inhibitor of apoptosis protein IAP-like protein XIAP API3 IAP3 BIRC4 Baculoviral IAP repeat-containing protein 4 RING-type E3 ubiquitin transferase XIAP protein protein human Homo sapiens Human MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENYLGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS DIP protein P98170 original sequence version: 168 DIP protein P98170 original sequence version: 118 DIP protein P98170 original sequence version: 153 9D394C16D45EB635 q9nr28-1 Diablo homolog, mitochondrial Direct IAP-binding protein with low pI Second mitochondria-derived activator of caspase DIABLO SMAC protein protein human Homo sapiens Human MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED DIP protein Q9NR28-1 original sequence version: 148 DIP protein Q9NR28-1 original sequence version: 101 diablo-xiap-2 2 3 unspecified role unspecified role unspecified role unspecified role 238-358 binding region 238-358 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role 56-217 binding region 56-217 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction xiap-diablo-2 1 3 unspecified role unspecified role bait bait 238-358 binding region 238-358 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range P98170:p.Glu314Ala E314A mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E314A mutation'. Wed May 02 19:16:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu314ala' Tue Jun 30 20:16:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu314Ala' P98170:p.Glu314Arg E314R mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E R This feature has been corrected as a result of our quality control procedures. The original label was 'E314R mutation'. Wed May 02 15:06:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu314arg' Tue Jun 30 19:15:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu314Arg' P98170:p.Gln319Ala Q319A mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q A This feature has been corrected as a result of our quality control procedures. The original label was 'Q319A mutation'. Wed May 02 15:46:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln319ala' Tue Jun 30 19:20:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln319Ala' P98170:p.Gln319Arg Q319R mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q R This feature has been corrected as a result of our quality control procedures. The original label was 'Q319R mutation'. Wed May 02 16:10:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln319arg' Tue Jun 30 18:59:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln319Arg' P98170:p.Trp323Ala W323A mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W323A mutation'. Wed May 02 16:13:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp323ala' Tue Jun 30 16:04:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp323Ala' P98170:p.Trp323Arg W323R mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain W R This feature has been corrected as a result of our quality control procedures. The original label was 'W323R mutation'. Wed May 02 19:52:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp323arg' Tue Jun 30 18:20:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp323Arg' ecolx Escherichia coli 4 unspecified role unspecified role prey prey 56-217 binding region 56-217 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction