IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The carboxy-terminal cysteine of the tetraspanin L6 antigen is required for its interaction with SITAC, a novel PDZ protein. The carboxy-terminal cysteine of the tetraspanin L6 antigen is required for its interaction with SITAC, a novel PDZ protein. Molecular biology of the cell 2000 imex curation Borrell-Pagès M., Fernández-Larrea J., Borroto A., Rojo F., Baselga J., Arribas J. jarribas@hg.vhebron.es 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Borrell-Pagès M., Fernández-Larrea J., Borroto A., Rojo F., Baselga J., Arribas J. jarribas@hg.vhebron.es Accepted 2017-NOV-08 AT 12:56 GMT AT 12:56 GMT by ORCHARD Molecular biology of the cell 2000 imex curation I have removed the "X" mutation. I do not see how I can amalgamate the mutated Baits as there is no wild type shown for residue 157 (fig 3A) for "SITAC". EBI-16418792 - I have altered Fig 3B val159cys mutation to "increasing" as the fig shows the "wild" type (V) at residue 159. The carboxy-terminal cysteine of the tetraspanin L6 antigen is required for its interaction with SITAC, a novel PDZ protein. The carboxy-terminal cysteine of the tetraspanin L6 antigen is required for its interaction with SITAC, a novel PDZ protein. Molecular biology of the cell 2000 imex curation Borrell-Pagès M., Fernández-Larrea J., Borroto A., Rojo F., Baselga J., Arribas J. jarribas@hg.vhebron.es 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Borrell-Pagès M., Fernández-Larrea J., Borroto A., Rojo F., Baselga J., Arribas J. jarribas@hg.vhebron.es Accepted 2017-NOV-08 AT 12:56 GMT AT 12:56 GMT by ORCHARD Molecular biology of the cell 2000 imex curation I have removed the "X" mutation. I do not see how I can amalgamate the mutated Baits as there is no wild type shown for residue 157 (fig 3A) for "SITAC". EBI-16418792 - I have altered Fig 3B val159cys mutation to "increasing" as the fig shows the "wild" type (V) at residue 159. The carboxy-terminal cysteine of the tetraspanin L6 antigen is required for its interaction with SITAC, a novel PDZ protein. The carboxy-terminal cysteine of the tetraspanin L6 antigen is required for its interaction with SITAC, a novel PDZ protein. Molecular biology of the cell 2000 imex curation Borrell-Pagès M., Fernández-Larrea J., Borroto A., Rojo F., Baselga J., Arribas J. jarribas@hg.vhebron.es 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Borrell-Pagès M., Fernández-Larrea J., Borroto A., Rojo F., Baselga J., Arribas J. jarribas@hg.vhebron.es Accepted 2017-NOV-08 AT 12:56 GMT AT 12:56 GMT by ORCHARD Molecular biology of the cell 2000 imex curation I have removed the "X" mutation. I do not see how I can amalgamate the mutated Baits as there is no wild type shown for residue 157 (fig 3A) for "SITAC". EBI-16418792 - I have altered Fig 3B val159cys mutation to "increasing" as the fig shows the "wild" type (V) at residue 159. sdcb1_human Syntenin-1 Scaffold protein Pbp1 Pro-TGF-alpha cytoplasmic domain-interacting protein 18 Syndecan-binding protein 1 Melanoma differentiation-associated protein 9 SDCBP MDA9 SYCL protein protein human Homo sapiens Human MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV DIP protein O00560 original sequence version: 87 DIP protein O00560-1 original sequence version: 117 574E1349F86F949F jag1_human Protein jagged-1 JAG1 JAGL1 protein protein human Homo sapiens Human MRSPRTRGRSGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSLGFECECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKPCVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYAGDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCRNGGTCIDGVNSYKCICSDGWEGAYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICAQNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGYRCVCPPGHSGAKCQEVSGRPCITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPRPCLLHKGHSECPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCANITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAEDIRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVAWICCLVTAFYWCLRKRRKPGSHTHSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYENKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNGTPTKHPNWTNKQDNRDLESAQSLNRMEYIV DIP protein P78504 original sequence version: 95 F36EE9FBF64DF162 t4s1_human Transmembrane 4 L6 family member 1 Tumor-associated antigen L6 Membrane component chromosome 3 surface marker 1 TM4SF1 TAAL6 M3S1 protein protein human Homo sapiens Human MCYGKCARCIGHSLVGLALLCIAANILLYFPNGETKYASENHLSRFVWFFSGIVGGGLLMLLPAFVFIGLEQDDCCGCCGHENCGKRCAMLSSVLAALIGIAGSGYCVIVAALGLAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSILLALGGIEFILCLIQVINGVLGGICGFCCSHQQQYDC 80D82C47902B8CD4 tgfa_rat Protransforming growth factor alpha Tgfa protein protein rat Rattus norvegicus (Rat) Rat MVPAAGQLALLALGILVAVCQALENSTSPLSDSPVAAAVVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV E9664EF04DFCF4D5 sdcb2_human Syntenin-2 Similar to TACIP18 SDCBP2 SITAC18 Syndecan-binding protein 2 protein protein human Homo sapiens Human MSSLYPSLEDLKVDQAIQAQVRASPKMPALPVQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQIPEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDA E12536839E1CD91C sdcbp2-tgfa-1 3 7 unspecified role unspecified role bait bait P01134:p.Thr157Phe mutation mutation certain certain sequence position certain certain certain sequence position certain T F Wed May 02 16:57:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr157phe' Tue Jun 30 19:40:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr157Phe' cytoplasmic_tail sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association 3A-1 SITAC shows a restricted specificity, typical of type II PDZs, because it binds preferentially to the C-terminus of proteins that contain a hydrophobic amino acid in position -2 tgfa-sdcbp2-1 3 7 unspecified role unspecified role bait bait P01134:p.Thr157Gly mutation mutation certain certain sequence position certain certain certain sequence position certain T G Wed May 02 18:42:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr157gly' Tue Jun 30 19:42:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr157Gly' cytoplasmic_tail sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association 3A-2 weak binding tgfa-sdcbp2-2 3 7 unspecified role unspecified role bait bait P01134:p.Thr157Trp mutation mutation certain certain sequence position certain certain certain sequence position certain T W Wed May 02 16:04:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr157trp' Tue Jun 30 19:49:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr157Trp' cytoplasmic_tail sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association 3A-3 SITAC shows a restricted specificity, typical of type II PDZs, because it binds preferentially to the C-terminus of proteins that contain a hydrophobic amino acid in position -2 tgfa-sdcbp2-3 3 7 unspecified role unspecified role bait bait P01134:p.Thr157Tyr mutation mutation certain certain sequence position certain certain certain sequence position certain T Y Wed May 02 19:12:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr157tyr' Tue Jun 30 16:39:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr157Tyr' cytoplasmic_tail sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association 3A-4 tgfa-sdcbp2-4 3 7 unspecified role unspecified role bait bait P01134:p.Thr157Tyr mutation mutation certain certain sequence position certain certain certain sequence position certain T Y Wed May 02 19:24:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr157tyr' Tue Jun 30 17:47:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr157Tyr' cytoplasmic_tail sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P01134:p.Val159Cys mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain V C Wed May 02 17:32:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val159cys' Tue Jun 30 20:07:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val159Cys' 8 unspecified role unspecified role prey prey physical association physical association 3B, 4 in addition to baits containing V, baits containing C in position 0 showed interaction with SITAC tgfa-sdcbp-1 3 7 unspecified role unspecified role bait bait cytoplasmic_tail sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey physical association physical association 3 Most TGF-alpha mutants tested interacted with TACIP18. TACIP18 shows a very relaxed specificity in position -2. Probably NO mutations should be entered, just leaving the comment - I have entered TGF-a mutation(s) as "X" mutation with NO effect -as almost all bind. (if you really want I can enter all of them- but....) tgfa-sdcbp2-5 3 7 unspecified role unspecified role bait bait P01134:p.Thr157Tyr mutation mutation certain certain sequence position certain certain certain sequence position certain T Y Wed May 02 16:28:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr157tyr' Tue Jun 30 17:47:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr157Tyr' cytoplasmic_tail sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P01134:p.Val159Cys mutation mutation certain certain sequence position certain certain certain sequence position certain V C Wed May 02 17:02:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val159cys' Tue Jun 30 20:21:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val159Cys' 8 unspecified role unspecified role prey prey PDZ1PDZ2C_construct sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain physical association physical association 3C tgfa-sdcbp2-6 3 6 unspecified role unspecified role bait bait c_terminal_tail sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association 4B tm4sf1-sdcbp2-1 3 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait c_terminal_tail sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4B-2 tm4sf1-sdcbp2-2 1 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait loop3_myc_tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag range range range range P30408:p.Cys202Gly mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C G Wed May 02 17:51:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys202gly' Tue Jun 30 19:36:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys202Gly' physical association physical association 5B The third-loop myc tag is attached to somewhere in the more N-terminal region of the extracellular domain aas 115-161. The text above figure 5 states that Myc1/L6A was used - which has the third-loop myc tag. However the figure legend for 5B states that Myc2/L6A was used, which has an N-terminal tag. tm4sf1-sdcbp2-3 2 6 unspecified role unspecified role neutral component neutral component n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P30408:p.Cys202Gly mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C G Wed May 02 19:28:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys202gly' Tue Jun 30 17:23:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys202Gly' 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 5C The third-loop myc tag is attached to somewhere in the more N-terminal region of the extracellular domain aas 115-161. The text above figure 5 states that Myc1/L6A was used - which has the third-loop myc tag. However the figure legend for 5B states that Myc2/L6A was used, which has an N-terminal tag.