DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Desulfovibrio desulfuricans iron hydrogenase: the structure shows unusual coordination to an active site Fe binuclear center. Desulfovibrio desulfuricans iron hydrogenase: the structure shows unusual coordination to an active site Fe binuclear center. Structure (London, England : 1993) 1999 imex curation Nicolet Y., Piras C., Legrand P., Hatchikian CE., Fontecilla-Camps JC. Only protein-protein interactions desvh Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nicolet Y., Piras C., Legrand P., Hatchikian CE., Fontecilla-Camps JC. DIP original experiment: DIP-263241X Structure (London, England : 1993) 1999 IMEx Desulfovibrio desulfuricans iron hydrogenase: the structure shows unusual coordination to an active site Fe binuclear center. phfl_desvh Periplasmic [Fe] hydrogenase large subunit hydA Fe hydrogenlyase DVU_1769 protein protein desvh Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) MSRTVMERIEYEMHTPDPKADPDKLHFVQIDEAKCIGCDTCSQYCPTAAIFGEMGEPHSIPHIEACINCGQCLTHCPENAIYEAQSWVPEVEKKLKDGKVKCIAMPAPAVRYALGDAFGMPVGSVTTGKMLAALQKLGFAHCWDTEFTADVTIWEEGSEFVERLTKKSDMPLPQFTSCCPGWQKYAETYYPELLPHFSTCKSPIGMNGALAKTYGAERMKYDPKQVYTVSIMPCIAKKYEGLRPELKSSGMRDIDATLTTRELAYMIKKAGIDFAKLPDGKRDSLMGESTGGATIFGVTGGVMEAALRFAYEAVTGKKPDSWDFKAVRGLDGIKEATVNVGGTDVKVAVVHGAKRFKQVCDDVKAGKSPYHFIEYMACPGGCVCGGGQPVMPGVLEAMDRTTTRLYAGLKKRLAMASANKA DIP protein P07598 original sequence version: 126 8E70A0775B68AACD phfs_desvh Periplasmic [Fe] hydrogenase small subunit hydB Fe hydrogenlyase small chain DVU_1770 protein protein desvh Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) MQIASITRRGFLKVACVTTGAALIGIRMTGKAVAAVKQIKDYMLDRINGVYGADAKFPVRASQDNTQVKALYKSYLEKPLGHKSHDLLHTHWFDKSKGVKELTTAGKLPNPRASEFEGPYPYE DIP protein P07603 original sequence version: 116 2F4F7A4304ECD47B hyda-hydb-3 1 3 unspecified role unspecified role unspecified role unspecified role desvh Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) 2 unspecified role unspecified role unspecified role unspecified role desvh Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) direct interaction direct interaction