IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Enhancing the Cytotoxic Effects of PARP Inhibitors with DNA Demethylating Agents - A Potential Therapy for Cancer. Enhancing the Cytotoxic Effects of PARP Inhibitors with DNA Demethylating Agents - A Potential Therapy for Cancer. Cancer cell 2016 imex curation Muvarak NE., Chowdhury K., Xia L., Robert C., Choi EY., Cai Y., Bellani M., Zou Y., Singh ZN., Duong VH., Rutherford T., Nagaria P., Bentzen SM., Seidman MM., Baer MR., Lapidus RG., Baylin SB., Rassool FV. Cancer - Interactions investigated in the context of cancer frassool@som.umaryland.edu Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Muvarak NE., Chowdhury K., Xia L., Robert C., Choi EY., Cai Y., Bellani M., Zou Y., Singh ZN., Duong VH., Rutherford T., Nagaria P., Bentzen SM., Seidman MM., Baer MR., Lapidus RG., Baylin SB., Rassool FV. Cancer - Interactions investigated in the context of cancer frassool@som.umaryland.edu Accepted 2017-FEB-21 AT 09:44 GMT AT 09:44 GMT by ORCHARD Cancer cell 2016 imex curation altered - I have put in a comment instead Enhancing the Cytotoxic Effects of PARP Inhibitors with DNA Demethylating Agents - A Potential Therapy for Cancer. Enhancing the Cytotoxic Effects of PARP Inhibitors with DNA Demethylating Agents - A Potential Therapy for Cancer. Cancer cell 2016 imex curation Muvarak NE., Chowdhury K., Xia L., Robert C., Choi EY., Cai Y., Bellani M., Zou Y., Singh ZN., Duong VH., Rutherford T., Nagaria P., Bentzen SM., Seidman MM., Baer MR., Lapidus RG., Baylin SB., Rassool FV. Cancer - Interactions investigated in the context of cancer frassool@som.umaryland.edu Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Muvarak NE., Chowdhury K., Xia L., Robert C., Choi EY., Cai Y., Bellani M., Zou Y., Singh ZN., Duong VH., Rutherford T., Nagaria P., Bentzen SM., Seidman MM., Baer MR., Lapidus RG., Baylin SB., Rassool FV. Cancer - Interactions investigated in the context of cancer frassool@som.umaryland.edu Accepted 2017-FEB-21 AT 09:44 GMT AT 09:44 GMT by ORCHARD Cancer cell 2016 imex curation altered - I have put in a comment instead Enhancing the Cytotoxic Effects of PARP Inhibitors with DNA Demethylating Agents - A Potential Therapy for Cancer. Enhancing the Cytotoxic Effects of PARP Inhibitors with DNA Demethylating Agents - A Potential Therapy for Cancer. Cancer cell 2016 imex curation Muvarak NE., Chowdhury K., Xia L., Robert C., Choi EY., Cai Y., Bellani M., Zou Y., Singh ZN., Duong VH., Rutherford T., Nagaria P., Bentzen SM., Seidman MM., Baer MR., Lapidus RG., Baylin SB., Rassool FV. Cancer - Interactions investigated in the context of cancer frassool@som.umaryland.edu Only protein-protein interactions human-mv4-11 Human MV4-11, Acute Monocytic Leukemia cell line mv4-11 MV4-11 a human MLL leukemia cell line https://www.lgcstandards-atcc.org/Products/All/CRL-9591.aspx Human acute monocytic leukemia cell line. Described to carry a 4;11 translocation; MV4-11 carries an FLT3 internal tandem duplication. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Muvarak NE., Chowdhury K., Xia L., Robert C., Choi EY., Cai Y., Bellani M., Zou Y., Singh ZN., Duong VH., Rutherford T., Nagaria P., Bentzen SM., Seidman MM., Baer MR., Lapidus RG., Baylin SB., Rassool FV. Cancer - Interactions investigated in the context of cancer frassool@som.umaryland.edu Accepted 2017-FEB-21 AT 09:44 GMT AT 09:44 GMT by ORCHARD Cancer cell 2016 imex curation altered - I have put in a comment instead Enhancing the Cytotoxic Effects of PARP Inhibitors with DNA Demethylating Agents - A Potential Therapy for Cancer. Enhancing the Cytotoxic Effects of PARP Inhibitors with DNA Demethylating Agents - A Potential Therapy for Cancer. Cancer cell 2016 imex curation Muvarak NE., Chowdhury K., Xia L., Robert C., Choi EY., Cai Y., Bellani M., Zou Y., Singh ZN., Duong VH., Rutherford T., Nagaria P., Bentzen SM., Seidman MM., Baer MR., Lapidus RG., Baylin SB., Rassool FV. Cancer - Interactions investigated in the context of cancer frassool@som.umaryland.edu Only protein-protein interactions human-mv4-11 Human MV4-11, Acute Monocytic Leukemia cell line mv4-11 MV4-11 a human MLL leukemia cell line https://www.lgcstandards-atcc.org/Products/All/CRL-9591.aspx Human acute monocytic leukemia cell line. Described to carry a 4;11 translocation; MV4-11 carries an FLT3 internal tandem duplication. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Muvarak NE., Chowdhury K., Xia L., Robert C., Choi EY., Cai Y., Bellani M., Zou Y., Singh ZN., Duong VH., Rutherford T., Nagaria P., Bentzen SM., Seidman MM., Baer MR., Lapidus RG., Baylin SB., Rassool FV. Cancer - Interactions investigated in the context of cancer frassool@som.umaryland.edu Accepted 2017-FEB-21 AT 09:44 GMT AT 09:44 GMT by ORCHARD Cancer cell 2016 imex curation altered - I have put in a comment instead Enhancing the Cytotoxic Effects of PARP Inhibitors with DNA Demethylating Agents - A Potential Therapy for Cancer. Enhancing the Cytotoxic Effects of PARP Inhibitors with DNA Demethylating Agents - A Potential Therapy for Cancer. Cancer cell 2016 imex curation Muvarak NE., Chowdhury K., Xia L., Robert C., Choi EY., Cai Y., Bellani M., Zou Y., Singh ZN., Duong VH., Rutherford T., Nagaria P., Bentzen SM., Seidman MM., Baer MR., Lapidus RG., Baylin SB., Rassool FV. Cancer - Interactions investigated in the context of cancer frassool@som.umaryland.edu Only protein-protein interactions human-nccit Human NCCIT-a mediastinal mixed germ cell tumor-pluripotent stem cell line. nccit Human NCCIT pluripotent stem cell line,from a mediastinal mixed germ cell tumor. http://www.lgcstandards-atcc.org/LGCAdvancedCatalogueSearch/ProductDescription/tabid/1068/Default.aspx?ATCCNum=CRL-2073&Template=cellBiology anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Muvarak NE., Chowdhury K., Xia L., Robert C., Choi EY., Cai Y., Bellani M., Zou Y., Singh ZN., Duong VH., Rutherford T., Nagaria P., Bentzen SM., Seidman MM., Baer MR., Lapidus RG., Baylin SB., Rassool FV. Cancer - Interactions investigated in the context of cancer Nuclear extracts from untreated cells or cells treated with 2 mM H2O2 for 30 min were added to a 15%–60% sucrose gradient. Fractions were pooled into five groups and Co-IPs were performed with control IgG or anti-DNMT3B (3B) antibodies. Larger fraction numbers indicate larger molecular weight of the complexes. frassool@som.umaryland.edu Accepted 2017-FEB-21 AT 09:44 GMT AT 09:44 GMT by ORCHARD Cancer cell 2016 imex curation altered - I have put in a comment instead Enhancing the Cytotoxic Effects of PARP Inhibitors with DNA Demethylating Agents - A Potential Therapy for Cancer. Enhancing the Cytotoxic Effects of PARP Inhibitors with DNA Demethylating Agents - A Potential Therapy for Cancer. Cancer cell 2016 imex curation Muvarak NE., Chowdhury K., Xia L., Robert C., Choi EY., Cai Y., Bellani M., Zou Y., Singh ZN., Duong VH., Rutherford T., Nagaria P., Bentzen SM., Seidman MM., Baer MR., Lapidus RG., Baylin SB., Rassool FV. Cancer - Interactions investigated in the context of cancer frassool@som.umaryland.edu Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Muvarak NE., Chowdhury K., Xia L., Robert C., Choi EY., Cai Y., Bellani M., Zou Y., Singh ZN., Duong VH., Rutherford T., Nagaria P., Bentzen SM., Seidman MM., Baer MR., Lapidus RG., Baylin SB., Rassool FV. Cancer - Interactions investigated in the context of cancer Cells were treated with low doses of AZA (5-azacytidine, a DNA methyltransferase inhibitor) and/or BMN (talazoparib-a PARP inhibitor). Site-specific DNA damage was then induced using a laser to induce DSBs. Cells were fixed at various time points after laser damage. frassool@som.umaryland.edu Accepted 2017-FEB-21 AT 09:44 GMT AT 09:44 GMT by ORCHARD Cancer cell 2016 imex curation altered - I have put in a comment instead dnmt1_human DNA (cytosine-5)-methyltransferase 1 CXXC9 MCMT DNA methyltransferase HsaI CXXC-type zinc finger protein 9 DNMT1 AIM DNMT protein protein human Homo sapiens Human MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRRSKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKPQEESERAKSDESIKEEDKDQDEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQKLKEEPDREARAGVQADEDEDGDEKDEKKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVMNSKTHPPKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQHKLTCFSVYCKHGHLCPIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIGFSTSFAEYILMDPSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTVPPSGLNLNRFTEDSLLRHAQFVVEQVESYDEAGDSDEQPIFLTPCMRDLIKLAGVTLGQRRAQARRQTIRHSTREKDRGPTKATTTKLVYQIFDTFFAEQIEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDMVKFGGSGRSKQACQERRCPNMAMKEADDDEEVDDNIPEMPSPKKMHQGKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVLEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRVNKFYRPENTHKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMGGPNRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEIKLPKLRTLDVFSGCGGLSEGFHQAGISDTLWAIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLVMAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD DIP protein P26358 original sequence version: 171 DIP protein P26358-1 original sequence version: 121 DIP protein P26358 original sequence version: 121 DIP protein P26358-1 original sequence version: 128 DIP protein P26358 original sequence version: 128 1E833192D22AFA5B sir1_human NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 SIRT1 SIR2L1 SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein human Homo sapiens Human MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS DIP protein Q96EB6 original sequence version: 140 DIP protein Q96EB6 original sequence version: 71 DIP protein Q96EB6 original sequence version: 125 DIP protein Q96EB6 original sequence version: 115 DIP protein Q96EB6 original sequence version: 63 DIP protein Q96EB6-1 original sequence version: 102 DIP protein Q96EB6 original sequence version: 102 DIP protein Q96EB6 original sequence version: 98 DIP protein Q96EB6 original sequence version: 144 DIP protein Q96EB6 original sequence version: 120 DIP protein Q96EB6-1 original sequence version: 120 DIP protein Q96EB6 original sequence version: 113 DIP protein Q96EB6-1 original sequence version: 117 2D3BEA6D73DA229F dnm3b_human DNA (cytosine-5)-methyltransferase 3B DNMT3B DNA methyltransferase HsaIIIB protein protein human Homo sapiens Human MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEFPATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKPNNTQPVVNKSKVRRAGSRKLESRKYENKTRRRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQMASDVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRKDWNVRLQAFFTSDTGLEYEAPKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGKYVASEVCEESIAVGTVKHEGNIKYVNDVRNITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLECNPVMIDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYNRIAKLKKVQTITTKSNSIKQGKNQLFPVVMNGKEDVLWCTELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE DIP protein Q9UBC3 original sequence version: 148 DIP protein Q9UBC3 original sequence version: 83 F20A67CF78951532 parp1_human Poly [ADP-ribose] polymerase 1 PARP1 ADPRT PPOL NAD(+) ADP-ribosyltransferase 1 Poly[ADP-ribose] synthase 1 ADP-ribosyltransferase diphtheria toxin-like 1 DNA ADP-ribosyltransferase PARP1 Protein poly-ADP-ribosyltransferase PARP1 protein protein human Homo sapiens Human MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW DIP protein P09874 original sequence version: 189 DIP protein P09874 original sequence version: 183 DIP protein P09874 original sequence version: 166 DIP protein P09874 original sequence version: 117 DIP protein P09874 original sequence version: 143 DIP protein P09874 original sequence version: 136 DIP protein P09874 original sequence version: 137 DIP protein P09874 original sequence version: 147 DIP protein P09874 original sequence version: 193 DIP protein P09874 original sequence version: 202 DIP protein P09874 original sequence version: 171 DIP protein P09874 original sequence version: 153 DIP protein P09874 original sequence version: 175 6A5FC01EB91C046B h2ax_human Histone H2AX H2AX H2AFX Histone H2A.X protein protein human Homo sapiens Human MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY DIP protein P16104 original sequence version: 114 DIP protein P16104 original sequence version: 110 DIP protein P16104 original sequence version: 117 DIP protein P16104 original sequence version: 133 DIP protein P16104 original sequence version: 140 DIP protein P16104 original sequence version: 113 DIP protein P16104 original sequence version: 99 D4683775C2E6C3A9 mta1_human Metastasis-associated protein MTA1 MTA1 protein protein human Homo sapiens Human MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISSTLIALADKHATLSVCYKAGPGADNGEEGEIEEEMENPEMVDLPEKLKHQLRHRELFLSRQLESLPATHIRGKCSVTLLNETESLKSYLEREDFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDLLKEGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYNKPNPNQISVNNVKAGVVNGTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASCWTYWKKYGGLKMPTRLDGERPGPNRSNMSPHGLPARSSGSPKFAMKTRQAFYLHTTKLTRIARRLCREILRPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRPPPPAPVNDEPIVIED DIP protein Q13330 original sequence version: 146 DIP protein Q13330-1 original sequence version: 127 2D5330F0489AE62E mta2_human Metastasis-associated protein MTA2 MTA2 MTA1L1 PID Metastasis-associated 1-like 1 p53 target protein in deacetylase complex protein protein human Homo sapiens Human MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAGFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAARRPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPVPLPAPSHPASTNEPIVLED DIP protein O94776 original sequence version: 128 DIP protein O94776 original sequence version: 122 DIP protein O94776 original sequence version: 85 DIP protein O94776 original sequence version: 120 DIP protein O94776 original sequence version: 130 DIP protein O94776 original sequence version: 146 65087AF798BA64EC ezh2_human Histone-lysine N-methyltransferase EZH2 KMT6 Enhancer of zeste homolog 2 ENX-1 Lysine N-methyltransferase 6 EZH2 protein protein human Homo sapiens Human MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP DIP protein Q15910 original sequence version: 97 DIP protein Q15910 original sequence version: 94 DIP protein Q15910 original sequence version: 92 DIP protein Q15910 original sequence version: 96 DIP protein Q15910 original sequence version: 122 DIP protein Q15910 original sequence version: 100 1B5029EB9D509BE5 dnmt1-parp1-6 1 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 1A parp1-dnmt1-2 1 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 1Ai dnmt1-parp1-2 4 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 1B parp1-dnmt1-1 4 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 1B Camptothecin (CHEBI:27656) - topoisomerase I inhibitor, binding to topo I and DNA,stabilizing DNA and preventing religation. Methyl methanesulfonate (CHEBI:25255) -an alkylating agent dnmt1-parp1-3 6 10 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization 2A, Supp 4 AZA and BMN, combined and separately dnmt3b-ezh2-12 5 10 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Supp 1A Fraction no 1, untreated cells dnmt3b-ezh2-1 5 10 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey association association Supp 1A-2 Fraction 2, untreated cells dnmt3b-ezh2-10 5 9 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association Supp 1A-3 Fraction no 3, untreated cells dnmt3b-ezh2-11 5 10 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Supp 1A-4 Fraction no 1, cells treated with 2mm H2O2 dnmt3b-dnmt1-2 5 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey association association Supp 1A-5 Fraction number 2, cells treated with 2mm H2O2 dnmt3b-dnmt1-3 5 10 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association Supp 1A-6 Fraction number 3, cells treated with 2mm H2O2 35ye5y-1 2 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association Supp 1B Another protein(s) was recovered- "MacroH2A", but cannot be unambiguously identified. h2afx-parp1-1 3 11 unspecified role unspecified role neutral component neutral component ser140 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm 10 unspecified role unspecified role neutral component neutral component colocalization colocalization Supp 1C the RHS graph appears to be empty. I cannot find an even remotely appropriate GO entry for "chromatin fibre/filament" Camptothecin (CHEBI:27656)-- topoisomerase I inhibitor, binding to topo I and DNA,stabilizing DNA and preventing religation. ionizing radiation (IR, 10 Gy) dnmt1-parp1-4 6 11 unspecified role unspecified role neutral component neutral component ser140 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm 7 unspecified role unspecified role neutral component neutral component colocalization colocalization Supp 3-1 AZA and BMN, combined and separately dnmt1-parp1-5 6 11 unspecified role unspecified role neutral component neutral component ser140 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm 10 unspecified role unspecified role neutral component neutral component colocalization colocalization Supp 3-2 AZA and BMN, combined and separately