HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Interactions of surface-displayed glycolytic enzymes of Mycoplasma pneumoniae with components of the human extracellular matrix. Interactions of surface-displayed glycolytic enzymes of Mycoplasma pneumoniae with components of the human extracellular matrix. International journal of medical microbiology : IJMM 2016 imex curation Gründel A., Jacobs E., Dumke R. roger.dumke@tu-dresden.de 18-Apr-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Gründel A., Jacobs E., Dumke R. M. pneumoniae interactions with human Laminin and Fibrinogen were not added since the protein subunit identities could not be traced. roger.dumke@tu-dresden.de Accepted 2017-MAR-28 AT 10:19 BST AT 10:19 BST by MGT International journal of medical microbiology : IJMM 2016 imex curation odpa_mycpn Pyruvate dehydrogenase E1 component subunit alpha MP445 MPN_393 pdhA protein protein mycpn Mycoplasma pneumoniae (strain ATCC 29342 / M129) MAILIKNKVPTTLYQVYDNEGKLMDPNHKITLSNEQLKHAFYLMNLSRIMDKKMLVWQRAGKMLNFAPNLGEEALQVGMGMGLNENDWFCPTFRSGALMLYRGVKPEQLLLYWNGNENGSKIEAKYKTLPINITIGAQYSHAAGLGYMLHYKKLPNVAVTMIGDGGTAEGEFYEAMNIASIHKWNSVFCINNNQFAISTRTKLESAVSDLSTKAIAVNIPRIRVDGNDLIASYEAMHEAANYARSGNGPVLIEFFSWRQGPHTTSDDPSIYRTKEEEAEAMKSDPVKRLRNFLFDRGILTPQQEEEMVAKIEQEVQAAYEVMVSKTPVTLDEVFDYNYEKLTPDLARQKAEAKKYFKD E6184A2026D7A143 sodium chloride sodium chloride chlorure de sodium cloruro sodico common salt halite Kochsalz NaCl natrii chloridum Natriumchlorid rock salt salt sodium chloride table salt sodium chloride small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) odp2_mycpn Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex E2 Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex MP447 MPN_391 pdhC protein protein mycpn Mycoplasma pneumoniae (strain ATCC 29342 / M129) MANEFKFTDVGEGLHEGKVTEILKKVGDTIKVDEALFVVETDKVTTELPSPYAGVITAITTNVGDVVHIGQVMAVIDDGAGAAAPAAPQPVSAPAPAPTPTFTPTPAPVTTEPVVEEAGASVVGEIKVSNSVFPIFGVQPSAPQPTPAPVVQPTSAPTPTPAPASAAAPSGEETIAITTMRKAIAEAMVKSHENIPATILTFYVNATKLKQYRESVNGLALSKYNMKISFFAFFVKAIVNALKKFPVFNGRYDKERNLIVLNKDVNVGIAVDTPDGLIVPNIKQAQTKSVVDIAKDIVDLANRARSKQIKLPDLSKGTISVTNFGSLGAAFGTPIIKHPEMCIVATGNMEERVVRAEGGVAVHTILPLTIAADHRWVDGADVGRFGKEIAKQIEELIDLEVA F09314A9E714A1D6 trfl_human Lactotransferrin LTF LF Talalactoferrin GIG12 Growth-inhibiting protein 12 protein protein human Homo sapiens Human MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAARRARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYTAGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRKPVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK DIP protein P02788 original sequence version: 141 DIP protein P02788 original sequence version: 187 0489CABA6D13C098 kpyk_mycpn Pyruvate kinase MP533 MPN_303 pyk protein protein mycpn Mycoplasma pneumoniae (strain ATCC 29342 / M129) MIHHLKRTKIIATCGPALTKKLWTLAMLDDPAYAAMKAEAYANIENIIKNGVTVIRLNFSHGNHEEQAVRIKIVRDVAKKLNLPVSIMLDTNGPEIRVFETAPEGLKILKDSEVVINTTTKEVAKNNQFSVSDASGTYNMVNDVKVGQKILVDDGKLSLVVKRIDTKNNQVICVAQNDHTIFTKKRLNLPNADYSIPFLSAKDLRDIDFGLTHQIDYIAASFVNTTENIKQLRDYLASKNAKHVKLIAKIESNHALNNIDGIIKASDGIMVARGDLGLEIPYYKVPYWQRYMIKACRFFNKRVITATQMLDSLEKNIQPTRAEVTDVYFAVDRGNDATMLSGETANGAFPLNAVYVMKMIDKQSETFFDYQYNLNYYMANSKARHSEFWKQVVLPLAQKTAPKRKLINSDFKYDFVVHATNNLNEIYALSNARLAAAVIILTNDPQVYTGHGVDYGIFPYLIDQKPQSLSKAEFKSLANVAIKHYQQHGEISQLKQCLGVFHNKIISL 011D97377F8BB527 ldh_mycpn L-lactate dehydrogenase MP168 MPN_674 ldh protein protein mycpn Mycoplasma pneumoniae (strain ATCC 29342 / M129) MKSLKVALIGSGAVGTSFLYAAMSRGLASEYMVIDINEKSQVGNVFDLQDAVPSSPQYSKVIAGDYKQLKDYDFIFIGAGRPQKQGGETRLQLLEGNVEIMKNIAKAVKESGFKGITLIASNPVDIMAYTYLKVTGFEPNKVIGSGTLLDSARLKFAIAEKYGMSSRDVQAYVLGEHGDSSVSIISSAKIAGLPLKHFSKASDIEKEFAEIDHFIRRRAYEIIERKGATFYGIGEATAEVAELILRDTKEVRVVASLINGQYGAKDVMFGTPCVLGRNGVEKILEIELSATEKAGLDKSIQVLKDNIKLAKL 604F58CD3B6C273A tkt_mycpn Transketolase tktA tkt MP073 MPN_082 protein protein mycpn Mycoplasma pneumoniae (strain ATCC 29342 / M129) MKNLFACQHLALSAIQHAKGGHVGMALGASPILYTLWTKHIQFNPNCPKWINRDRLVMSAGHGSMALYPILHFAGLITKQEMLHHKYGQVNTSSHPEYAPNNFIDASTGPLGQGLGMAVGMALTQRVLAAEFKALSPKLFDHFTYVVVGDGDLQEGVSYEVAHLAGVYQLNKLIVLHDSNRVQMDSVVRDVSLENLQTRFTNMGWNYLETSDAVADIDAAIKQAKKSDKPTFIEVHTTIAKNTTLEDQPAGHWFIPTDKDFARFNSNTKTNFTPFEYPQTVYDFFHKQVIARQAKPVQAYKELLEKLKDKPLYTKFINWTENDYQALYLNQLDERKVAQANAATRNYLKDFLGQINNSNSNLYCLNADVARSCNIKLGDDNLHTNPHSRNIQVGIREFGMSTIMNGMALHGGVKVMGGTFLAFADYSKPAIRLGALMNLPTFYVYTHDSYQVGGDGPTHQPYDQLPMLRAIENVQVWRPCDEKETAAGVNYGLLSQDQTNVLILTRQALPSLEQSDSVQTLKGGYIISNRKQPDVIVAASGSEVQLALQLEQALNEQQLKTRVVSVPNINMLLSQPQSYLQQLFDPNSVLLTLEASASMEWYALAKYVKKHTHLGAFSFGESNDGQVVYEHKGFNVTNLLKLIKTLKS EFE8247D7F0837C9 finc_human Fibronectin FN1 FN Cold-insoluble globulin protein protein human Homo sapiens Human MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHPQPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPVTSNTVTGETTPFSPLVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDTTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGTPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNTFAEVTGLSPGVTYYFKVFAVSHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPPRAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPASEYTVSLVAIKGNQESPKATGVFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVSGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISDTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFVTHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNVGEEIQIGHIPREDVDYHLYPHGPGLNPNASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNVIVEALKDQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE DIP protein P02751 original sequence version: 119 DIP protein P02751 original sequence version: 131 DIP protein P02751 original sequence version: 154 DIP protein P02751 original sequence version: 156 DIP protein P02751 original sequence version: 157 DIP protein P02751 original sequence version: 155 DIP protein P02751 original sequence version: 194 6C436A7A5FEE6DEB vtnc_human Vitronectin VTN Serum-spreading factor V75 S-protein protein protein human Homo sapiens Human MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL DIP protein P04004 original sequence version: 115 0D6DB5591CBFEF45 sodium bromide sodium bromide Bromide salt of sodium Bromnatrium NaBr Trisodium tribromide small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) gpmi_mycpn 2,3-bisphosphoglycerate-independent phosphoglycerate mutase pgm MP214 MPN_628 gpmI protein protein mycpn Mycoplasma pneumoniae (strain ATCC 29342 / M129) MHKKVLLAILDGYGISNKQHGNAVYHAKTPALDSLIKDYPCVMLEASGEAVGLPQGQIGNSEVGHLNIGAGRIVYTGLSLINQNIKTGAFHHNQVLLEAIARAKANNAKLHLIGLFSHGGVHSHMDHLYALIKLAAPQVKMVLHLFGDGRDVAPCTMKSDLEAFMVFLKDYHNVIIGTLGGRYYGMDRDQRWDREEIAYNAILGNSKASFTDPVAYVQSAYDQKVTDEFLYPAVNGNVDKEQFALKDHDSVIFFNFRPDRARQMSHMLFQTDYYDYTPKAGRKYNLFFVTMMNYEGIKPSAVVFPPETIPNTFGEVIAHNKLKQLRIAETEKYAHVTFFFDGGVEVDLPNETKCMVPSLKVATYDLAPEMACKGITDQLLNQINQFDLTVLNFANPDMVGHTGNYAACVQGLEALDVQIQRIIDFCKANHITLFLTADHGNAEEMIDSNNNPVTKHTVNKVPFVCTDTNIDLQQDSASLANIAPTILAYLGLKQPAEMTANSLLISKK A856375375B09F5E odpb_mycpn Pyruvate dehydrogenase E1 component subunit beta MP446 MPN_392 pdhB protein protein mycpn Mycoplasma pneumoniae (strain ATCC 29342 / M129) MSKTIQANNIEALGNAMDLALERDPNVVLYGQDAGFEGGVFRATKGLQKKYGEERVWDCPIAEAAMAGIGVGAAIGGLKPIVEIQFSGFSFPAMFQIFTHAARIRNRSRGVYTCPIIVRMPMGGGIKALEHHSETLEAIYGQIAGLKTVMPSNPYDTKGLFLAAVESPDPVVFFEPKKLYRAFRQEIPADYYTVPIGQANLISQGNNLTIVSYGPTMFDLINMVYGGELKDKGIELIDLRTISPWDKETVFNSVKKTGRLLVVTEAAKTFTTSGEIIASVTEELFSYLKAAPQRVTGWDIVVPLARGEHYQFNLNARILEAVNQLLK 06513520FDAFED54 g3p_mycpn Glyceraldehyde-3-phosphate dehydrogenase gap MP411 MPN_430 gapA NAD-dependent glyceraldehyde-3-phosphate dehydrogenase protein protein mycpn Mycoplasma pneumoniae (strain ATCC 29342 / M129) MLAKSKTIRVAINGFGRIGRLVFRALLSQKNIEIVAVNDLTHPDTLAHLLKYDSAHGEFKKKVVAKDNTLMIDKKKVLVFSEKDPANLPWAEHNIDIVVESTGRFVSEEGASLHLQAGAKRVIISAPAKQKTIKTVVYNVNHKIINAEDKIISAASCTTNCLAPMVHVLEKNFGILHGTMVTVHAYTADQRLQDAPHSDLRRARAAACNIVPTTTGAAKAIGLVVPEATGKLNGMALRVPVLTGSIVELCVALEKDATVEQINQAMKKAASASFRYCEDEIVSSDIVGSEHGSIFDSKLTNIIEVDGNKLYKVYAWYDNESSYVNQLVRVVNYCAKL 550747A529ABCA83 pdha-ltf-1 1 5 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 3 inhibitor inhibitor unspecified role unspecified role physical association physical association fig 3&4, table 1&2 pdhb-ltf-1 1 3 inhibitor inhibitor unspecified role unspecified role 5 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pdhc-ltf-1 1 3 inhibitor inhibitor unspecified role unspecified role 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 gapa-ltf-1 1 3 inhibitor inhibitor unspecified role unspecified role 5 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pyk-ltf-1 1 3 inhibitor inhibitor unspecified role unspecified role 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pdha-vtn-1 1 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 2 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 3 inhibitor inhibitor unspecified role unspecified role physical association physical association fig 3&4, table 1&2 pdhb-vtn-1 1 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 13 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 3 inhibitor inhibitor unspecified role unspecified role physical association physical association fig 3&4, table 1&2 pdhc-vtn-1 1 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 4 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 gpmi-vtn-1 1 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 12 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 gapa-vtn-1 1 3 inhibitor inhibitor unspecified role unspecified role 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 14 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pyk-vtn-1 1 3 inhibitor inhibitor unspecified role unspecified role 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 6 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 tkt-vtn-1 1 3 inhibitor inhibitor unspecified role unspecified role 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 8 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 ldh-vtn-1 1 3 inhibitor inhibitor unspecified role unspecified role 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 7 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pdhc-fn1-1 1 9 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 4 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 gapa-fn1-2 1 3 inhibitor inhibitor unspecified role unspecified role 9 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 14 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 gapa-fn1-1 1 9 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 14 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 gapa-fn1-3 1 11 inhibitor inhibitor unspecified role unspecified role 9 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 14 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 gapa-ltf-2 1 5 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 gapa-ltf-3 1 11 inhibitor inhibitor unspecified role unspecified role 5 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 gapa-vtn-2 1 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 14 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 gapa-vtn-3 1 11 inhibitor inhibitor unspecified role unspecified role 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 14 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 gpmi-vtn-2 1 11 inhibitor inhibitor unspecified role unspecified role 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 12 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 ldh-vtn-2 1 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 7 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 ldh-vtn-3 1 11 inhibitor inhibitor unspecified role unspecified role 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 7 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pdha-ltf-2 1 5 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pdha-ltf-3 1 11 inhibitor inhibitor unspecified role unspecified role 5 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pdha-vtn-2 1 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 2 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pdha-vtn-3 1 11 inhibitor inhibitor unspecified role unspecified role 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 2 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pdhb-ltf-2 1 5 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pdhb-ltf-3 1 11 inhibitor inhibitor unspecified role unspecified role 5 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pdhb-vtn-2 1 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 13 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pdhb-vtn-3 1 11 inhibitor inhibitor unspecified role unspecified role 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 13 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pdhc-fn1-2 1 11 inhibitor inhibitor unspecified role unspecified role 9 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 4 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pdhc-ltf-2 1 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pdhc-ltf-3 1 11 inhibitor inhibitor unspecified role unspecified role 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pyk-ltf-2 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pyk-ltf-3 1 11 inhibitor inhibitor unspecified role unspecified role 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pyk-vtn-2 1 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 6 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 pyk-vtn-3 1 11 inhibitor inhibitor unspecified role unspecified role 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 6 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 tkt-vtn-2 1 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 8 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2 tkt-vtn-3 1 11 inhibitor inhibitor unspecified role unspecified role 10 unspecified role unspecified role prey prey human-plasma homo sapiens blood plasma plasma blood plasma 8 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association fig 3&4, table 1&2