IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Cancer cell 2016 imex curation Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study western blot western blot Immuno blot Immuno blot Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es Accepted 2017-JAN-20 AT 11:41 GMT AT 11:41 GMT by ORCHARD Cancer cell 2016 imex curation Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Cancer cell 2016 imex curation Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Glucose deprivation present absent Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es Accepted 2017-JAN-20 AT 11:41 GMT AT 11:41 GMT by ORCHARD Cancer cell 2016 imex curation Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Cancer cell 2016 imex curation Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Glucose deprivation absent present Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es Accepted 2017-JAN-20 AT 11:41 GMT AT 11:41 GMT by ORCHARD Cancer cell 2016 imex curation Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Cancer cell 2016 imex curation Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es Accepted 2017-JAN-20 AT 11:41 GMT AT 11:41 GMT by ORCHARD Cancer cell 2016 imex curation Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Cancer cell 2016 imex curation Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es Accepted 2017-JAN-20 AT 11:41 GMT AT 11:41 GMT by ORCHARD Cancer cell 2016 imex curation Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Cancer cell 2016 imex curation Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es Accepted 2017-JAN-20 AT 11:41 GMT AT 11:41 GMT by ORCHARD Cancer cell 2016 imex curation Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Cancer cell 2016 imex curation Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es Accepted 2017-JAN-20 AT 11:41 GMT AT 11:41 GMT by ORCHARD Cancer cell 2016 imex curation Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Cancer cell 2016 imex curation Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es Accepted 2017-JAN-20 AT 11:41 GMT AT 11:41 GMT by ORCHARD Cancer cell 2016 imex curation Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Cancer cell 2016 imex curation Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer NO species for MYC-OGT Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es Accepted 2017-JAN-20 AT 11:41 GMT AT 11:41 GMT by ORCHARD Cancer cell 2016 imex curation Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Cancer cell 2016 imex curation Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es Accepted 2017-JAN-20 AT 11:41 GMT AT 11:41 GMT by ORCHARD Cancer cell 2016 imex curation Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Cancer cell 2016 imex curation Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es Accepted 2017-JAN-20 AT 11:41 GMT AT 11:41 GMT by ORCHARD Cancer cell 2016 imex curation Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Cancer cell 2016 imex curation Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-snu-449 human hepatocellular carcinoma cell line. snu-449 human hepatocellular carcinoma cell line. liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es Accepted 2017-JAN-20 AT 11:41 GMT AT 11:41 GMT by ORCHARD Cancer cell 2016 imex curation Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Cancer cell 2016 imex curation Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es Accepted 2017-JAN-20 AT 11:41 GMT AT 11:41 GMT by ORCHARD Cancer cell 2016 imex curation Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Cancer cell 2016 imex curation Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es Accepted 2017-JAN-20 AT 11:41 GMT AT 11:41 GMT by ORCHARD Cancer cell 2016 imex curation Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Cancer cell 2016 imex curation Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es Accepted 2017-JAN-20 AT 11:41 GMT AT 11:41 GMT by ORCHARD Cancer cell 2016 imex curation Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Cancer cell 2016 imex curation Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es Accepted 2017-JAN-20 AT 11:41 GMT AT 11:41 GMT by ORCHARD Cancer cell 2016 imex curation Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Regulation of OGT by URI in Response to Glucose Confers c-MYC-Dependent Survival Mechanisms. Cancer cell 2016 imex curation Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions human-snu-398 human hepatocellular carcinoma Human snu-398 https://www.lgcstandards-atcc.org/Products/All/CRL-2233 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Burén S., Gomes AL., Teijeiro A., Fawal MA., Yilmaz M., Tummala KS., Perez M., Rodriguez-Justo M., Campos-Olivas R., Megías D., Djouder N. Cancer - Interactions investigated in the context of cancer Results from Figure 3F:- Protein Kinase Assay using Bovine "PKA" have not been included as the identity of the PKA subunits are not stated on the suppliers web site (Sigma P2645) 2/11/16 -email sent for Myc-OGT construct -in expt-3.No reply. Please note that at Interaction level, -Summary view, the number of Expt conditions does not reflect the number actually entered - often shows the number "2" when one or none are present. N-terminal His and HA tagged URI and mutants; human origin was deduced by mutation mapping.(Djouder 2007 reference). HA tagged PP1-gamma of Rattine origin from same publication. HA/GST-OGT;human origin found from Teo-2010 (supplementary ref)/Daou-2012 (supplementary ref.) Myc-OGT as used in Figure 1K: (Chen -2013 Ref)- No origin can be found, and mutation mapping for the "Gly428Ser mutation is not possible as no Gly at position 428 can be found and no info is given on the "D2" mutant. ndjouder@cnio.es Accepted 2017-JAN-20 AT 11:41 GMT AT 11:41 GMT by ORCHARD Cancer cell 2016 imex curation ogt1_human UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit O-linked N-acetylglucosamine transferase 110 kDa subunit O-GlcNAc transferase subunit p110 OGT protein protein human Homo sapiens Human MASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA DIP protein O15294 original sequence version: 165 DIP protein O15294 original sequence version: 147 852ED68BDDE63363 o94763-1 Unconventional prefoldin RPB5 interactor 1 URI1 C19orf2 NNX3 PPP1R19 RMP URI Protein NNX3 Protein phosphatase 1 regulatory subunit 19 RNA polymerase II subunit 5-mediating protein protein protein human Homo sapiens Human MEAPTVETPPDPSPPSAPAPALVPLRAPDVARLREEQEKVVTNCQERIQHWKKVDNDYNALRERLSTLPDKLSYNIMVPFGPFAFMPGKLVHTNEVTVLLGDNWFAKCSAKQAVGLVEHRKEHVRKTIDDLKKVMKNFESRVEFTEDLQKMSDAAGDIVDIREEIKCDFEFKAKHRIAHKPHSKPKTSDIFEADIANDVKSKDLLADKELWARLEELERQEELLGELDSKPDTVIANGEDTTSSEEEKEDRNTNVNAMHQVTDSHTPCHKDVASSEPFSGQVNSQLNCSVNGSSSYHSDDDDDDDDDDDDDNIDDDDGDNDHEALGVGDNSIPTIYFSHTVEPKRVRINTGKNTTLKFSEKKEEAKRKRKNSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPEAFSGTVIEKEFVSPSLTPPPAIAHPALPTIPERKEVLLEASEETGKRVSKFKAARLQQKD DBB046A392E3C752 tab1_human TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 TAB1 MAP3K7IP1 TGF-beta-activated kinase 1-binding protein 1 Mitogen-activated protein kinase kinase kinase 7-interacting protein 1 protein protein human Homo sapiens Human MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLESIDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTLLVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGAHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVVTAP DIP protein Q15750 original sequence version: 74 DIP protein Q15750 original sequence version: 110 DIP protein Q15750 original sequence version: 111 A45743288718983A rmp_human Unconventional prefoldin RPB5 interactor 1 URI1 C19orf2 NNX3 PPP1R19 Protein NNX3 Protein phosphatase 1 regulatory subunit 19 RMP RNA polymerase II subunit 5-mediating protein URI protein protein human Homo sapiens Human MEAPTVETPPDPSPPSAPAPALVPLRAPDVARLREEQEKVVTNCQERIQHWKKVDNDYNALRERLSTLPDKLSYNIMVPFGPFAFMPGKLVHTNEVTVLLGDNWFAKCSAKQAVGLVEHRKEHVRKTIDDLKKVMKNFESRVEFTEDLQKMSDAAGDIVDIREEIKCDFEFKAKHRIAHKPHSKPKTSDIFEADIANDVKSKDLLADKELWARLEELERQEELLGELDSKPDTVIANGEDTTSSEEEKEDRNTNVNAMHQVTDSHTPCHKDVASSEPFSGQVNSQLNCSVNGSSSYHSDDDDDDDDDDDDDNIDDDDGDNDHEALGVGDNSIPTIYFSHTVEPKRVRINTGKNTTLKFSEKKEEAKRKRKNSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPEAFSGTVIEKEFVSPSLTPPPAIAHPALPTIPERKEVLLEASEETGKRVSKFKAARLQQKD DBB046A392E3C752 pp1g_rat Serine/threonine-protein phosphatase PP1-gamma catalytic subunit Ppp1cc Protein phosphatase 1C catalytic subunit protein protein rat Rattus norvegicus (Rat) Rat MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK 4E28412C16898615 pp1g_human Serine/threonine-protein phosphatase PP1-gamma catalytic subunit PPP1CC Protein phosphatase 1C catalytic subunit protein protein human Homo sapiens Human MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK DIP protein P36873 original sequence version: 169 DIP protein P36873 original sequence version: 177 0EEEF0E842188536 q346t4-1 12 22 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O94763-1:p.Ser372Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:01:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser372ala' Tue Jun 30 17:21:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser372Ala' O94763-1:p.Ser372Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S D Wed May 02 16:55:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser372asp' Tue Jun 30 20:17:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser372Asp' in vitro In vitro physical association physical association 1C, Supp 1J, Supp 5S ogt-ppp1cc-1 17 25 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey association association 1F OGT siRNA ogt-uri1-1 12 26 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 22 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 25 unspecified role unspecified role prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) association association 1H ogt-ppp1cc-2 17 25 unspecified role unspecified role prey prey 27 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait association association 1A uri1-ogt-2 10 22 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 25 unspecified role unspecified role bait bait n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 2G uri1-ogt-3 1 24 enzyme target enzyme target substrate substrate neutral component neutral component n_acetyl_glycosyl glycores glycosylated residue GlycoRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 22 enzyme enzyme neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 25 inhibitor inhibitor neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) glycosylation glycosylation reaction glycosylation 2Hi O94763 decreases activity of O15294 ogt-tab1-1 1 24 enzyme target enzyme target substrate substrate neutral component neutral component n_acetyl_glycosyl glycores glycosylated residue GlycoRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 22 enzyme enzyme neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) glycosylation glycosylation reaction glycosylation 2H, Supp 2M uri1-1 18 27 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey physical association physical association 5 A,C,M, Supp 5M Forskolin - activates adenylyl cyclase and hence cAMP-dependent PKA . Glucose deprivation Rotenone prevented URI/PP1-gamma dissociation under conditions of glucose deprivation. 2-deoxy-D-glucose (a competitively inhibitor of glucose-6-PO4 formation from glucose, thus inhibiting glycolysis) Rapamycin ppp1cc-uri1-2 5 27 unspecified role unspecified role bait bait 23 unspecified role unspecified role prey prey O94763-1:p.Ser372Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:08:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser372ala' Tue Jun 30 20:20:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser372Ala' n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 6 5 F In the absence of glucose deprivation the ser372ala mutation had no effect. ppp1cc-uri1-3 5 27 unspecified role unspecified role bait bait 23 unspecified role unspecified role prey prey O94763-1:p.Ser372Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S A Wed May 02 20:19:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser372ala' Tue Jun 30 16:41:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser372Ala' n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 7 5 Fi The Ser372Ala mutation increased binding under conditions of glucose deprivation. ppp1cc-uri1-4 11 27 unspecified role unspecified role bait bait 23 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5 Fii Glucose deprivation ppp1cc-uri1-5 2 27 unspecified role unspecified role bait bait 23 unspecified role unspecified role prey prey O94763-1:p.Ser372Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:24:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser372ala' Tue Jun 30 19:53:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser372Ala' n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22 unspecified role unspecified role prey prey association association 3 5 G The Ser372Ala mutation increased binding under conditions of glucose deprivation. ppp1cc-uri1-6 9 27 unspecified role unspecified role bait bait 23 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22 unspecified role unspecified role prey prey association association 5 G Glucose deprivation Glucose deprivation decreases the amount of URI precipitated, but it is unclear if the precipitation of OGT is affected. ppp1cc-uri1-7 9 27 unspecified role unspecified role bait bait 23 unspecified role unspecified role prey prey O94763-1:p.Ser372Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S D Wed May 02 17:00:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser372asp' Tue Jun 30 20:03:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser372Asp' O94763-1:p.Ser372Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:58:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser372ala' Tue Jun 30 19:48:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser372Ala' n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5H uri1-ogt-5 13 25 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp Fig 1A/C uri1-ogt-9 20 25 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp Fig 1E ppp1cc-uri1-8 18 22 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey association association Supp Fig 1H, Supp 5I Glucose deprivation reduced URI binding, but not OGT binding. Re-adding glucose to glucose-deprived cells did not restore URI/PP1gamma binding. ogt-ppp1cc-3 12 26 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 22 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Supp 1J uri1-ogt-6 13 27 unspecified role unspecified role bait bait 23 unspecified role unspecified role prey prey O94763-1:p.Ser372Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S A Wed May 02 14:37:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser372ala' Tue Jun 30 17:07:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser372Ala' n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey physical association physical association Supp Fig 1L ogt-uri1-2 12 26 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P63088:p.Leu289_Cys291delinsArgAlaArg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain LMC RAR Wed May 02 19:57:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_met_cys289-291arg_ala_arg' Tue Jun 30 17:12:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu289_Cys291delinsArgAlaArg' P63088:p.Cys291Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C R Wed May 02 18:41:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys291arg' Tue Jun 30 18:20:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys291Arg' ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro physical association physical association Supp 1N + P ogt-ppp1cc-4 12 22 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 26 unspecified role unspecified role bait bait P63088:p.Cys291Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain C R Wed May 02 15:33:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys291arg' Tue Jun 30 18:20:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys291Arg' n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P63088:p.Leu289_Cys291delinsArgAlaArg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain LMC RAR Wed May 02 18:41:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_met_cys289-291arg_ala_arg' Tue Jun 30 19:11:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu289_Cys291delinsArgAlaArg' ecoli Escherichia coli (strain K12) physical association physical association Supp 1S ogt-tab1-2 1 24 enzyme target enzyme target substrate substrate neutral component neutral component n_acetyl_glycosyl glycores glycosylated residue GlycoRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 22 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) 25 inhibitor inhibitor neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) glycosylation glycosylation reaction glycosylation Supp 2M The presence of a bulky GST tag reduced the inhibition efficiency of URI. ogt-ppp1cc-5 17 25 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait physical association physical association Supp 5B Glucose deprivation reduced URI binding at 120 minutes but effects are unclear earlier. ppp1cc-ogt-1 19 27 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey association association 5 R, Supp 5D, Supp 5Q H89- a PKA inhibitor, increased the binding of URI to PP1-gamma under conditions of glucose deprivation. Binding of OGT was decreased. 3e5tar-1 14 22 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp 5O Glucose deprivation had no effect on binding. 45yeys-1 19 25 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association Supp 5P This interaction was not affected by glucose deprivation. uri1-ogt-7 10 22 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 25 unspecified role unspecified role prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Supp 5R PKA phosphorylated URI at ser372; both phosphorylated URI and the non-phosphorylated form have similar affinities to GST-OGT. ppp1cc-ogt-2 19 27 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey association association Supp 5Q Glucose deprivation prevented this interaction from occuring ppp1cc-ogt-3 2 27 unspecified role unspecified role bait bait 23 unspecified role unspecified role prey prey O94763-1:p.Ser372Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:54:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser372ala' Tue Jun 30 16:46:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser372Ala' n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22 unspecified role unspecified role prey prey association association 4 5 Gi The Ser372Ala mutation increased binding under conditions of glucose deprivation. uri1-ogt-8 15 22 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O94763-1:p.Ser372Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:58:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser372ala' Tue Jun 30 17:36:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser372Ala' O94763-1:p.Ser372Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S D Wed May 02 15:37:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser372asp' Tue Jun 30 19:06:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser372Asp' physical association physical association Supp 5T Glucose deprivation had no effect on binding. 4t634wt-1 8 22 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait association association Supp 5U ppp1cc-ogt-4 16 22 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait association association Supp 5U ppp1cc-ogt-5 21 22 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait association association Supp 5U