IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CC chemokine receptor 10 cell surface presentation in melanocytes is regulated by the novel interaction partner S100A10. CC chemokine receptor 10 cell surface presentation in melanocytes is regulated by the novel interaction partner S100A10. Scientific reports 2015 imex curation Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U., Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U. Dark Space =57? Hermann.Pavenstaedt@ukmuenster.de,rescher@uni-muenster.de Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U. Dark Space =57? Hermann.Pavenstaedt@ukmuenster.de,rescher@uni-muenster.de Accepted 2017-FEB-07 AT 11:43 GMT AT 11:43 GMT by ORCHARD Scientific reports 2015 imex curation CC chemokine receptor 10 cell surface presentation in melanocytes is regulated by the novel interaction partner S100A10. CC chemokine receptor 10 cell surface presentation in melanocytes is regulated by the novel interaction partner S100A10. Scientific reports 2015 imex curation Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U., Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U. Dark Space =57? Hermann.Pavenstaedt@ukmuenster.de,rescher@uni-muenster.de Only protein-protein interactions human-UKRV-Mel-4 UKRV-Mel-4 Melanoma cell line Human ukrv-mel-4 UKRV-Mel-4 Melanoma cell line confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U. Dark Space =57? Hermann.Pavenstaedt@ukmuenster.de,rescher@uni-muenster.de Accepted 2017-FEB-07 AT 11:43 GMT AT 11:43 GMT by ORCHARD Scientific reports 2015 imex curation CC chemokine receptor 10 cell surface presentation in melanocytes is regulated by the novel interaction partner S100A10. CC chemokine receptor 10 cell surface presentation in melanocytes is regulated by the novel interaction partner S100A10. Scientific reports 2015 imex curation Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U., Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U. Dark Space =57? Hermann.Pavenstaedt@ukmuenster.de,rescher@uni-muenster.de Only protein-protein interactions human-UKRV-Mel-4 UKRV-Mel-4 Melanoma cell line Human ukrv-mel-4 UKRV-Mel-4 Melanoma cell line pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U. Dark Space =57? Hermann.Pavenstaedt@ukmuenster.de,rescher@uni-muenster.de Accepted 2017-FEB-07 AT 11:43 GMT AT 11:43 GMT by ORCHARD Scientific reports 2015 imex curation CC chemokine receptor 10 cell surface presentation in melanocytes is regulated by the novel interaction partner S100A10. CC chemokine receptor 10 cell surface presentation in melanocytes is regulated by the novel interaction partner S100A10. Scientific reports 2015 imex curation Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U., Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U. Dark Space =57? Hermann.Pavenstaedt@ukmuenster.de,rescher@uni-muenster.de Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Hessner F., Dlugos CP., Chehab T., Schaefer C., Homey B., Gerke V., Weide T., Pavenstädt H., Rescher U. Dark Space =57? Hermann.Pavenstaedt@ukmuenster.de,rescher@uni-muenster.de Accepted 2017-FEB-07 AT 11:43 GMT AT 11:43 GMT by ORCHARD Scientific reports 2015 imex curation anxa2_human Annexin A2 ANXA2 ANX2 ANX2L4 CAL1H LPC2D Annexin-2 Annexin II Lipocortin II Calpactin I heavy chain Chromobindin-8 p36 Protein I Placental anticoagulant protein IV Calpactin-1 heavy chain protein protein human Homo sapiens Human MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD 5126E1337A0CBEA1 s10aa_human Protein S100-A10 S100 calcium-binding protein A10 Calpactin-1 light chain Calpactin I light chain p10 protein p11 Cellular ligand of annexin II S100A10 ANX2LG CAL1L CLP11 protein protein human Homo sapiens Human MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK 3E8E03A6E7DD7A8D s10aa_pig Protein S100-A10 S100A10 Calpactin I light chain Calpactin-1 light chain Cellular ligand of annexin II S100 calcium-binding protein A10 p10 protein p11 protein protein pig Sus scrofa (Pig) Pig MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGK AE03A6E7DD7A8D65 anxa2_pig Annexin A2 ANXA2 ANX2 Annexin-2 Annexin II Lipocortin II Calpactin I heavy chain Chromobindin-8 p36 Protein I Placental anticoagulant protein IV Calpactin-1 heavy chain protein protein pig Sus scrofa (Pig) Pig MSTVHEILCKLSLEGDHSTPASAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERYKSYSPYDMLESIKKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIXIMVSRSEVDMLKIRSEFKRKYGKSLYNYIQQDTKGDYQKALLYLCGGDD mint Calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity FAC554639119900D actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF DIP protein P60709 original sequence version: null DIP protein P60709 original sequence version: 63 DIP protein P60709 original sequence version: 128 DIP protein P60709 original sequence version: 129 DIP protein P60709 original sequence version: 58 DIP protein P60709 original sequence version: 66 DIP protein P60709 original sequence version: 88 DIP protein P60709 original sequence version: 89 DIP protein P60709 original sequence version: 86 DIP protein P60709 original sequence version: 138 DIP protein P60709 original sequence version: 112 6AFD05CA94E360E2 ccr10_human C-C chemokine receptor type 10 CCR10 GPR2 G-protein coupled receptor 2 protein protein human Homo sapiens Human MGTEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQPSVSLTVAALGLAGNGLVLATHLAARRAARSPTSAHLLQLALADLLLALTLPFAAAGALQGWSLGSATCRTISGLYSASFHAGFLFLACISADRYVAIARALPAGPRPSTPGRAHLVSVIVWLLSLLLALPALLFSQDGQREGQRRCRLIFPEGLTQTVKGASAVAQVALGFALPLGVMVACYALLGRTLLAARGPERRRALRVVVALVAAFVVLQLPYSLALLLDTADLLAARERSCPASKRKDVALLVTSGLALARCGLNPVLYAFLGLRFRQDLRRLLRGGSCPSGPQPRRGCPRRPRLSSCSAPTETHSLSWDN 736EB9B639AEA99A actb-ccr10-1 2 9 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 1A actb-ccr10-2 3 9 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 1B-3 S100A10 protein actb-ccr10-3 3 5 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 1B-2 S100A10 protein anxa2-ccr10-1 3 6 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 1B-1 anxa2-ccr10-2 1 6 unspecified role unspecified role prey prey human-UKRV-Mel-4 UKRV-Mel-4 Melanoma cell line Human ukrv-mel-4 UKRV-Mel-4 Melanoma cell line 5 unspecified role unspecified role prey prey human-UKRV-Mel-4 UKRV-Mel-4 Melanoma cell line Human ukrv-mel-4 UKRV-Mel-4 Melanoma cell line 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association 3A ccr10-anxa2-2 1 8 unspecified role unspecified role prey prey pig-intestinal mucosa pig Pig intestinal mucosa 7 unspecified role unspecified role prey prey pig-intestinal mucosa pig Pig intestinal mucosa 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association 3B-2 ccr10-anxa2-3 1 6 unspecified role unspecified role prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 3B, 4 ccr10-s100a10-1 4 6 unspecified role unspecified role prey prey P60903:p.Cys83Gln mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain C Q Wed May 02 16:25:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83gln' Tue Jun 30 17:04:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys83Gln' n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P60903:p.Cys83Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain C S Wed May 02 19:20:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83ser' Tue Jun 30 15:54:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys83Ser' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 47 50 direct interaction direct interaction 5 A+C, Supp fig 4 Kd values for mutants added at participant level ccr10-s100a10-2 1 6 unspecified role unspecified role prey prey P60903:p.Cys83Gln mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain C Q Wed May 02 18:10:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83gln' Tue Jun 30 19:31:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys83Gln' n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P60903:p.Cys83Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:47:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys83ser' Tue Jun 30 16:51:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys83Ser' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 59 56 direct interaction direct interaction 5B