HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Mycobacterium tuberculosis AtsG (Rv0296c), GlmU (Rv1018c) and SahH (Rv3248c) Proteins Function as the Human IL-8-Binding Effectors and Contribute to Pathogen Entry into Human Neutrophils. Mycobacterium tuberculosis AtsG (Rv0296c), GlmU (Rv1018c) and SahH (Rv3248c) Proteins Function as the Human IL-8-Binding Effectors and Contribute to Pathogen Entry into Human Neutrophils. PloS one 2015 imex curation Dziadek B., Brzostek A., Grzybowski M., Fol M., Krupa A., Kryczka J., Plocinski P., Kurdowska A., Dziadek J. jdziadek@cbm.pan.pl 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom sequence tag sequence tag identification sequence tag Dziadek B., Brzostek A., Grzybowski M., Fol M., Krupa A., Kryczka J., Plocinski P., Kurdowska A., Dziadek J. jdziadek@cbm.pan.pl Accepted 2016-JUL-25 AT 11:42 BST AT 11:42 BST by ORCHARD PloS one 2015 imex curation Mycobacterium tuberculosis AtsG (Rv0296c), GlmU (Rv1018c) and SahH (Rv3248c) Proteins Function as the Human IL-8-Binding Effectors and Contribute to Pathogen Entry into Human Neutrophils. Mycobacterium tuberculosis AtsG (Rv0296c), GlmU (Rv1018c) and SahH (Rv3248c) Proteins Function as the Human IL-8-Binding Effectors and Contribute to Pathogen Entry into Human Neutrophils. PloS one 2015 imex curation Dziadek B., Brzostek A., Grzybowski M., Fol M., Krupa A., Kryczka J., Plocinski P., Kurdowska A., Dziadek J. jdziadek@cbm.pan.pl 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Dziadek B., Brzostek A., Grzybowski M., Fol M., Krupa A., Kryczka J., Plocinski P., Kurdowska A., Dziadek J. jdziadek@cbm.pan.pl Accepted 2016-JUL-25 AT 11:42 BST AT 11:42 BST by ORCHARD PloS one 2015 imex curation Mycobacterium tuberculosis AtsG (Rv0296c), GlmU (Rv1018c) and SahH (Rv3248c) Proteins Function as the Human IL-8-Binding Effectors and Contribute to Pathogen Entry into Human Neutrophils. Mycobacterium tuberculosis AtsG (Rv0296c), GlmU (Rv1018c) and SahH (Rv3248c) Proteins Function as the Human IL-8-Binding Effectors and Contribute to Pathogen Entry into Human Neutrophils. PloS one 2015 imex curation Dziadek B., Brzostek A., Grzybowski M., Fol M., Krupa A., Kryczka J., Plocinski P., Kurdowska A., Dziadek J. jdziadek@cbm.pan.pl 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Dziadek B., Brzostek A., Grzybowski M., Fol M., Krupa A., Kryczka J., Plocinski P., Kurdowska A., Dziadek J. jdziadek@cbm.pan.pl Accepted 2016-JUL-25 AT 11:42 BST AT 11:42 BST by ORCHARD PloS one 2015 imex curation glmu_myctu Bifunctional protein GlmU glmU Rv1018c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTFPGDTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDGTSKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASKRASEMACQQPTQPPDADQTP C14DC76BD6E5EC86 il8_human Interleukin-8 Protein 3-10C T-cell chemotactic factor CXCL8 C-X-C motif chemokine 8 Chemokine (C-X-C motif) ligand 8 Emoctakin Granulocyte chemotactic protein 1 IL8 Monocyte-derived neutrophil chemotactic factor Monocyte-derived neutrophil-activating peptide Neutrophil-activating protein 1 protein protein human Homo sapiens Human MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS DIP protein P10145 original sequence version: 161 15C649996E89319F q6mx51_myctu Rv0296c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTSERATGQRENLLIVHWHDLGRYLGVYHHPDVYSPRLDRLAAEGILFTRAHATAPLCTPSRGSLFTGRYPQSNGLVGLAHHGWEYRTGVQTLPQLLSESGWYSALFGMQHETSYPKRLGFDEFDVSNSYCEYVVAKAQDWLHNRVPALDGQRFLLTAGFFETHRPYPHERYRPADSAAVELPDYLPDTPEVRQDVAEFYGSIATADEAVGRLLDTLADTGLDASTWVVFVTDHGPAFPRAKSTLYDAGTGIALIIRPPTRRAMAPRVYDELFSGVDLVPTLLDLLRLEVPADVEGVSHAPALLAPDTENAAVRDHVYTAKTYHDSFDPIRAIRTKEYSYIENYAPRPLLDLPWDIQESPAGMAVAPLVKAPRPQRELYDLRADPTETNNLLAGDDSTQGVAAIAADLAVRLHDWRQRTADVIPSDFAGSRIAERYTETYLRIHRKTPTGRSAIAADRGIDEHCS 390B91F34C0A728B sera_myctu D-3-phosphoglycerate dehydrogenase serA 2-oxoglutarate reductase MTV012.10 Rv2996c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSLPVVLIADKLAPSTVAALGDQVEVRWVDGPDRDKLLAAVPEADALLVRSATTVDAEVLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIPAADASLREHTWKRSSFSGTEIFGKTVGVVGLGRIGQLVAQRIAAFGAYVVAYDPYVSPARAAQLGIELLSLDDLLARADFISVHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFATEPCTDSPLFELAQVVVTPHLGASTAEAQDRAGTDVAESVRLALAGEFVPDAVNVGGGVVNEEVAPWLDLVRKLGVLAGVLSDELPVSLSVQVRGELAAEEVEVLRLSALRGLFSAVIEDAVTFVNAPALAAERGVTAEICKASESPNHRSVVDVRAVGADGSVVTVSGTLYGPQLSQKIVQINGRHFDLRAQGINLIIHYVDRPGALGKIGTLLGTAGVNIQAAQLSEDAEGPGATILLRLDQDVPDDVRTAIAAAVDAYKLEVVDLS 3B5696AAFD82A901 sahh_myctu Adenosylhomocysteinase ahcY sahH MTCY20B11.23c Rv3248c S-adenosyl-L-homocysteine hydrolase protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTGNLVTKNSLTPDVRNGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPDEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPANMILDDGGDATMLVLRGMQYEKAGVVPPAEEDDPAEWKVFLNLLRTRFETDKDKWTKIAESVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDNKYGTRHSLIDGINRGTDALIGGKKVLICGYGDVGKGCAEAMKGQGARVSVTEIDPINALQAMMEGFDVVTVEEAIGDADIVVTATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSIIVLSEGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDEYDNEVYRLPKHLDEKVARIHVEALGGHLTKLTKEQAEYLGVDVEGPYKPDHYRY 386EF292620E7327 il8-multi-1 1 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait association association 1 & S1 il8-atsg-1 2 6 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey purified purified direct interaction direct interaction 2 il8-sahh-1 2 8 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey purified purified direct interaction direct interaction 2 glmu-il8-1 2 4 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey purified purified direct interaction direct interaction 2 glmu-cxcl8-1 3 4 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait purified purified direct interaction direct interaction 3 q6mx51_myctu-cxcl8-1 3 6 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait purified purified direct interaction direct interaction 3 ahcy-cxcl8-1 3 8 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait purified purified direct interaction direct interaction 3