UniProt UniProt http://www.uniprot.org A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression. A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression. Molecular and cellular biology 2014 imex curation Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu Accepted 2016-APR-06 AT 09:10 BST AT 09:10 BST by MGT Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression. A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression. Molecular and cellular biology 2014 imex curation Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu Accepted 2016-APR-06 AT 09:10 BST AT 09:10 BST by MGT Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression. A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression. Molecular and cellular biology 2014 imex curation Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu Accepted 2016-APR-06 AT 09:10 BST AT 09:10 BST by MGT Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression. A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression. Molecular and cellular biology 2014 imex curation Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu Accepted 2016-APR-06 AT 09:10 BST AT 09:10 BST by MGT Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression. A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression. Molecular and cellular biology 2014 imex curation Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu Accepted 2016-APR-06 AT 09:10 BST AT 09:10 BST by MGT Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression. A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression. Molecular and cellular biology 2014 imex curation Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. 76NTERT cell lysates were incubated with glutathione-Sepharose bead-bound GST-ECD-FLAG and protein complexes eluted by cleaving the ECD-FLAG portion with PreScission protease. Eluted ECD-FLAG in complex with bound proteins was further affinity purified using FLAG beads and then eluted using excess FLAG peptide. vband@unmc.edu Accepted 2016-APR-06 AT 09:10 BST AT 09:10 BST by MGT Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression. A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression. Molecular and cellular biology 2014 imex curation Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu Accepted 2016-APR-06 AT 09:10 BST AT 09:10 BST by MGT Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression. A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression. Molecular and cellular biology 2014 imex curation Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu Accepted 2016-APR-06 AT 09:10 BST AT 09:10 BST by MGT Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation csk2b_human Casein kinase II subunit beta Phosvitin Protein G5a CSNK2B CK2N G5A protein protein human Homo sapiens Human MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR DIP protein P67870 original sequence version: 77 DIP protein P67870 original sequence version: 124 DIP protein P67870 original sequence version: 134 E465B1E699B0E0EC pihd1_mouse PIH1 domain-containing protein 1 Pih1d1 Nop17 Nucleolar protein 17 homolog protein protein mouse Mus musculus Mouse MADSTFLAPELSDTESMGEETVRFQELLLKASKELQQAQTARPDSTQIQPKPGFCVKTNSSEGKVFINICHSPSIPPPADVTEDELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSNFYLRMQNSDFLRELVVTIAREGLEDKYGLQLNPEWRMLKYRSFLGSISQQNIRSQQRPRIQELGTLDASGSLGTCHGPERPHLNLWLEAPDLLLAEVDLPKLDGAQGLALEIGENRLVIGGPQQLYHLDATVPLRINSEASRAAFHRRRKQLMVSMPLLTASS DIP protein Q9CQJ2 original sequence version: 82 8624B7EF592E3F59 ruvb2_human RuvB-like 2 RUVBL2 TIP48 TIP49B CGI-46 48 kDa TATA box-binding protein-interacting protein TIP49b Repressing pontin 52 51 kDa erythrocyte cytosolic protein INO80J TIP60-associated protein 54-beta INO80 complex subunit J protein protein human Homo sapiens Human MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS DIP protein Q9Y230 original sequence version: 92 DIP protein Q9Y230 original sequence version: 120 DIP protein Q9Y230 original sequence version: 142 DIP protein Q9Y230 original sequence version: 180 54C78E9C587D975A csk21_human Casein kinase II subunit alpha CSNK2A1 CK2A1 protein protein human Homo sapiens Human MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ DIP protein P68400 original sequence version: 88 DIP protein P68400 original sequence version: 78 DIP protein P68400 original sequence version: 100 DIP protein P68400 original sequence version: 110 DIP protein P68400 original sequence version: 125 DIP protein P68400 original sequence version: 136 D3B6F5D13FF7422D ecd_human Protein ecdysoneless homolog Human suppressor of GCR two ECD protein protein human Homo sapiens Human MEETMKLATMEDTVEYCLFLIPDESRDSDKHKEILQKYIERIITRFAPMLVPYIWQNQPFNLKYKPGKGGVPAHMFGVTKFGDNIEDEWFIVYVIKQITKEFPELVARIEDNDGEFLLIEAADFLPKWLDPENSTNRVFFCHGELCIIPAPRKSGAESWLPTTPPTIPQALNIITAHSEKILASESIRAAVNRRIRGYPEKIQASLHRAHCFLPAGIVAVLKQRPRLVAAAVQAFYLRDPIDLRACRVFKTFLPETRIMTSVTFTKCLYAQLVQQRFVPDRRSGYRLPPPSDPQYRAHELGMKLAHGFEILCSKCSPHFSDCKKSLVTASPLWASFLESLKKNDYFKGLIEGSAQYRERLEMAENYFQLSVDWPESSLAMSPGEEILTLLQTIPFDIEDLKKEAANLPPEDDDQWLDLSPDQLDQLLQEAVGKKESESVSKEEKEQNYDLTEVSESMKAFISKVSTHKGAELPREPSEAPITFDADSFLNYFDKILGPRPNESDSDDLDDEDFECLDSDDDLDFETHEPGEEASLKGTLDNLKSYMAQMDQELAHTCISKSFTTRNQVEPVSQTTDNNSDEEDSGTGESVMAPVDVDLNLVSNILESYSSQAGLAGPASNLLQSMGVQLPDNTDHRPTSKPTKN F9B0D2BBFDB38CAF pihd1_human PIH1 domain-containing protein 1 PIH1D1 NOP17 Nucleolar protein 17 homolog protein protein human Homo sapiens Human MANPKLLGMGLSEAEAIGADSARFEELLLQASKELQQAQTTRPESTQIQPQPGFCIKTNSSEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRELVITIAREGLEDKYNLQLNPEWRMMKNRPFMGSISQQNIRSEQRPRIQELGDLYTPAPGRAESGPEKPHLNLWLEAPDLLLAEVDLPKLDGALGLSLEIGENRLVMGGPQQLYHLDAYIPLQINSHESKAAFHRKRKQLMVAMPLLPVPS 074A9CD4037A4882 prp8_human Pre-mRNA-processing-splicing factor 8 Splicing factor Prp8 PRP8 homolog 220 kDa U5 snRNP-specific protein p220 PRPC8 PRPF8 protein protein human Homo sapiens Human MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA DIP protein Q6P2Q9 original sequence version: 48 DIP protein Q6P2Q9 original sequence version: 129 DIP protein Q6P2Q9 original sequence version: 104 E823A15C60EA61C9 rb_human Retinoblastoma-associated protein pRb pp110 p105-Rb RB1 p110-RB1 protein protein human Homo sapiens Human MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK DIP protein P06400 original sequence version: 102 DIP protein P06400 original sequence version: 195 DIP protein P06400 original sequence version: 204 DIP protein P06400 original sequence version: 126 DIP protein P06400 original sequence version: 151 DIP protein P06400 original sequence version: 153 DIP protein P06400 original sequence version: 181 DIP protein P06400 original sequence version: 184 DIP protein P06400 original sequence version: 213 DIP protein P06400 original sequence version: 208 DIP protein P06400 original sequence version: 174 DIP protein P06400 original sequence version: 212 DIP protein P06400 original sequence version: 179 DIP protein P06400 original sequence version: 146 C8E746111E19CC32 ruvb1_human RuvB-like 1 RUVBL1 NMP238 TIP49 TIP49A 49 kDa TATA box-binding protein-interacting protein TIP49a Pontin 52 Nuclear matrix protein 238 54 kDa erythrocyte cytosolic protein INO80H TIP60-associated protein 54-alpha INO80 complex subunit H protein protein human Homo sapiens Human MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK DIP protein Q9Y265 original sequence version: 82 DIP protein Q9Y265 original sequence version: 110 6095ADE692B1482B ecd_mouse Protein ecdysoneless homolog Ecd protein protein mouse Mus musculus Mouse MEGSGKLAMVEDAVEYHLFLIPDKARGTEEHREILQKYIERIMTQFAPILVPYIWQNQPFNLKYKPAKGGVPAHMYGMTKFGDNIEDEWFIVYVIKQITKEFPELVARVEDNDGEFLLIEAADFLPKWLDPDNSANRVFFHHGELCIIPVPRKSERIPWLPMTPPTIQQALSIISAHPEAVLASESIQAAVDRRVSGYPERVEASLHRAHCFLPAGIVAVLKQQPRLLSAAVQAFYLRDPIDLRACRVFKTFLPETRIMASVTFTKCLYAQLVQQKFVPDRRSGYGLPPPSHPQYRAYELGMKLAHGFEILCSKCSPHFSDSRKSLVTASPLWASFLESLKRNDYFKGLMDGSAQYQERLEMAKNYFQLSIHRPESSLAMSPGEEILTVLQTQPFDVAELKTEEADLPPEDDDQWLDLSPDQLDQLLQDAAGRKESQPGPQKEELQNYDVAQVSDSMKAFISKVSSHKGAELPRDPSEAPITFDADSFLNYFDKILGAKPQESDSEDDPGEEDVEGVDSDDDVGFEAQESESLKGALGSLKSYMARMDQELAHTSMGRSFTTRERLNKDPPSHTANDNSDEEDSGAGDCAVEAVDVDLNLISNILESYSSQAGLAGPASNLLHSMGVRLPDNADHNPQVSQ mint 679C6E2EE6404357 rpap3_human RNA polymerase II-associated protein 3 RPAP3 protein protein human Homo sapiens Human MTSANKAIELQLQVKQNAEELQDFMRDLENWEKDIKQKDMELRRQNGVPEENLPPIRNGNFRKKKKGKAKESSKKTREENTKNRIKSYDYEAWAKLDVDRILDELDKDDSTHESLSQESESEEDGIHVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASKENSYPKEADIVIKSTEGERKQIEAQQNKQQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETVLLLEPGNKQAVTELSKIKKELIEKGHWDDVFLDSTQRQNVVKPIDNPPHPGSTKPLKKVIIEETGNLIQTIDVPDSTTAAAPENNPINLANVIAATGTTSKKNSSQDDLFPTSDTPRAKVLKIEEVSDTSSLQPQASLKQDVCQSYSEKMPIEIEQKPAQFATTVLPPIPANSFQLESDFRQLKSSPDMLYQYLKQIEPSLYPKLFQKNLDPDVFNQIVKILHDFYIEKEKPLLIFEILQRLSELKRFDMAVMFMSETEKKIARALFNHIDKSGLKDSSVEELKKRYGG DIP protein Q9H6T3 original sequence version: 97 70D5A965E4F1EE35 pih1d1-ecd-1 3 14 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O95905:p.[Ser503Ala;Ser505Ala;Ser518Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:01:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser503ala,ser505ala,ser518ala' Tue Jun 30 19:33:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser503Ala;Ser505Ala;Ser518Ala]' O95905:p.[Ser503Ala;Ser505Ala;Ser518Ala;Ser572Ala;Ser579Ala;Ser584Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:31:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser503ala,ser505ala,ser518ala,ser572ala,ser579ala,ser584ala' Tue Jun 30 20:00:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser503Ala;Ser505Ala;Ser518Ala;Ser572Ala;Ser579Ala;Ser584Ala]' O95905:p.[Ser503Asp;Ser505Asp;Ser518Asp;Ser572Asp;Ser579Asp;Ser584Asp] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain S D Wed May 02 15:47:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser503asp,ser505asp,ser518asp,ser572asp,ser579asp,ser584asp' Tue Jun 30 20:10:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser503Asp;Ser505Asp;Ser518Asp;Ser572Asp;Ser579Asp;Ser584Asp]' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 4A, supplemental S3D ecd-pih1d1-1 7 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association 4B ecd-pih1d1-2 8 18 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 4C pih1d1-ecd-2 1 19 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection Transfected ECD mutants constructs 3S/A (ser503ala, ser505ala, ser518ala), 6S/A (ser503ala, ser505ala, ser518ala, ser572ala,ser579ala,ser564ala), and del499-527 were precipitated to the same extent as the wildtype association association 4D pih1d1-ecd-3 1 19 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait 13 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Transfected ECD mutants constructs 3S/A (ser503ala, ser505ala, ser518ala), 6S/A (ser503ala, ser505ala, ser518ala, ser572ala,ser579ala,ser564ala), and del499-527 were precipitated to the same extent as the wildtype association association 4E ecd-prpf8-1 6 15 unspecified role unspecified role prey prey cell lysate cell lysate human-76ntert human 76N TERT immortalized mammary epithelial cell line Human 76ntert 76N TERT immortalized mammary epithelial cell line 17 unspecified role unspecified role prey prey cell lysate cell lysate human-76ntert human 76N TERT immortalized mammary epithelial cell line Human 76ntert 76N TERT immortalized mammary epithelial cell line 13 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) association association 5A pih1d1-ecd-4 5 17 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Transfected ECD mutants construct 6S/A (ser503ala, ser505ala, ser518ala, ser572ala,ser579ala,ser564ala) precipitated to the same extent as the wildtype physical association physical association supplemental S4B ecd-ruvbl1-1 7 13 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association 5C PIH1D1 knock down does not change the association ecd-ruvbl1-2 3 17 unspecified role unspecified role prey prey cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 6A Only the full-length ECD interacts with RUVBL1. ecd-ruvbl1-3 3 17 unspecified role unspecified role prey prey cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 13 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 6B Only the full-length ECD interacts with RUVBL1. pih1d1-ecd-5 3 14 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 6E ecd-prpf8-2 1 15 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association supplemental S3E pih1d1-ecd-6 1 17 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait 13 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Transfected ECD mutants constructs 3S/A (ser503ala, ser505ala, ser518ala), 6S/A (ser503ala, ser505ala, ser518ala, ser572ala,ser579ala,ser564ala), and del499-527 were precipitated to the same extent as the wildtype association association supplemental S3A pih1d1-ecd-7 1 13 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 14 unspecified role unspecified role bait bait physical association physical association supplemental S3B Phosphatase treatment did not change the interaction ecd-pih1d1-3 1 13 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 14 unspecified role unspecified role prey prey physical association physical association supplemental S3C Phosphatase treatment did not change the interaction ecd-ruvbl1-4 2 17 unspecified role unspecified role prey prey cell lysate cell lysate human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association supplemental S4C ecd-ruvbl1-5 2 17 unspecified role unspecified role prey prey cell lysate cell lysate human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 14 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association supplemental S4E rb1-ecd-1 5 16 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Transfected ECD mutants construct 6S/A (ser503ala, ser505ala, ser518ala, ser572ala,ser579ala,ser564ala) precipitated to the same extent as the wildtype physical association physical association supplemental S4F ruvbl1-ecd-1 5 17 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Transfected ECD mutants construct 6S/A (ser503ala, ser505ala, ser518ala, ser572ala,ser579ala,ser564ala) precipitated to the same extent as the wildtype physical association physical association 5B csnk2a1-csnk2b-7 4 9 enzyme regulator enzyme regulator neutral component neutral component ecoli Escherichia coli (strain K12) 12 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) 13 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 3B