HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Haemophilus influenzae Type f Hijacks Vitronectin Using Protein H To Resist Host Innate Immunity and Adhere to Pulmonary Epithelial Cells. Haemophilus influenzae Type f Hijacks Vitronectin Using Protein H To Resist Host Innate Immunity and Adhere to Pulmonary Epithelial Cells. Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Al-Jubair T., Mukherjee O., Oosterhuis S., Singh B., Su YC., Fleury C., Blom AM., Törnroth-Horsefield S., Riesbeck K., Al-Jubair T., Mukherjee O., Oosterhuis S., Singh B., Su YC., Fleury C., Blom AM., Törnroth-Horsefield S., Riesbeck K. kristian.riesbeck@ med.lu.se 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Al-Jubair T., Mukherjee O., Oosterhuis S., Singh B., Su YC., Fleury C., Blom AM., Törnroth-Horsefield S., Riesbeck K., Al-Jubair T., Mukherjee O., Oosterhuis S., Singh B., Su YC., Fleury C., Blom AM., Törnroth-Horsefield S., Riesbeck K. kristian.riesbeck@ med.lu.se Accepted 2016-AUG-25 AT 10:40 BST AT 10:40 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Haemophilus influenzae Type f Hijacks Vitronectin Using Protein H To Resist Host Innate Immunity and Adhere to Pulmonary Epithelial Cells. Haemophilus influenzae Type f Hijacks Vitronectin Using Protein H To Resist Host Innate Immunity and Adhere to Pulmonary Epithelial Cells. Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Al-Jubair T., Mukherjee O., Oosterhuis S., Singh B., Su YC., Fleury C., Blom AM., Törnroth-Horsefield S., Riesbeck K., Al-Jubair T., Mukherjee O., Oosterhuis S., Singh B., Su YC., Fleury C., Blom AM., Törnroth-Horsefield S., Riesbeck K. kristian.riesbeck@ med.lu.se 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Al-Jubair T., Mukherjee O., Oosterhuis S., Singh B., Su YC., Fleury C., Blom AM., Törnroth-Horsefield S., Riesbeck K., Al-Jubair T., Mukherjee O., Oosterhuis S., Singh B., Su YC., Fleury C., Blom AM., Törnroth-Horsefield S., Riesbeck K. kristian.riesbeck@ med.lu.se Accepted 2016-AUG-25 AT 10:40 BST AT 10:40 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Haemophilus influenzae Type f Hijacks Vitronectin Using Protein H To Resist Host Innate Immunity and Adhere to Pulmonary Epithelial Cells. Haemophilus influenzae Type f Hijacks Vitronectin Using Protein H To Resist Host Innate Immunity and Adhere to Pulmonary Epithelial Cells. Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Al-Jubair T., Mukherjee O., Oosterhuis S., Singh B., Su YC., Fleury C., Blom AM., Törnroth-Horsefield S., Riesbeck K., Al-Jubair T., Mukherjee O., Oosterhuis S., Singh B., Su YC., Fleury C., Blom AM., Törnroth-Horsefield S., Riesbeck K. kristian.riesbeck@ med.lu.se 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Al-Jubair T., Mukherjee O., Oosterhuis S., Singh B., Su YC., Fleury C., Blom AM., Törnroth-Horsefield S., Riesbeck K., Al-Jubair T., Mukherjee O., Oosterhuis S., Singh B., Su YC., Fleury C., Blom AM., Törnroth-Horsefield S., Riesbeck K. kristian.riesbeck@ med.lu.se Accepted 2016-AUG-25 AT 10:40 BST AT 10:40 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation hpe_haei3 Surface-adhesin protein E pe CGSHi3655_04936 protein protein Haemophilus influenzae (strain NTHi 3655) Haemophilus influenzae (strain NTHi 3655) MKKIILTLSLGLLTACSAQIQKAEQNDMKLAPPTDVRSGYIRLVKNVNYYIDSESIWVDNQEPQIVHFDAVVNLDKGLYVYPEPKRYARSVRQYKILNCANYHLTQVRTDFYDEFWGQGLRAAPKKQKKHTLSLTPDTTLYNAAQIICANYGKAFSVDKK D6F1115CD7C5DD00 a0a024a2c9_haeif lph tbp2 ERS515280_00355 protein protein haeif Haemophilus influenzae MNINLKKFSLTILAALTLTACGSGSGASASNAPTAQPSTPATQPSEQAVLEMPKRSPTNTGLVFSIKTESEEDSVGQINTINNEQELSNRTLTSIDVDGKQIPIAFTENWNEAKYIEQPLNGVPHICCNKYTAMRFGAIASNEAGQNDILFYNGIPTEKLPDSGEVTYEGESIMTSKESVIPDDYMKGSSKFIVNFGDKKLSGSLIIDTTKSTSSSQKVKIDIEKAKITGNTFSGTAQSDSFKSQGIAEGKFYGDGAKELGGMVKAKDNSWAGAYGAKAQ 78C3AE0668651BB4 heparin Heparin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) cfah_human Complement factor H CFH HF HF1 HF2 H factor 1 protein protein human Homo sapiens Human MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR DIP protein P08603 original sequence version: 161 DIP protein P08603-1 original sequence version: 149 3C26D62A2BF9BFEE vtnc_human Vitronectin VTN Serum-spreading factor V75 S-protein protein protein human Homo sapiens Human MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL DIP protein P04004 original sequence version: 115 0D6DB5591CBFEF45 ph-vn-1 1 6 inhibitor inhibitor unspecified role unspecified role 8 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 3B ph-fh-2 1 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 1A pe-vn-1 1 8 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 4 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) physical association physical association 2A ph-vn-2 1 8 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 2A, 2C, 3C and Supp. Figs 1 and 2 Interaction was not disrupted by addition of Factor H ph-vn-3 3 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 2B lph-vtn-2 1 8 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 1A lph-cfh-1 1 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 2D and S2 Interaction was not disrupted by addition of Vitronectin lph-vtn-3 2 8 unspecified role unspecified role unspecified role unspecified role region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role unspecified role unspecified role purified purified ecoli Escherichia coli (strain K12) physical association physical association 1D & 3E lph-vtn-4 2 5 unspecified role unspecified role unspecified role unspecified role purified purified haeif Haemophilus influenzae 8 unspecified role unspecified role unspecified role unspecified role region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1C and 3D lph-vtn-1 1 8 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-12513397]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 0-0, sequence length 478 [EBI-12513397]0-0 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Supp. Figs 1 Interaction was not disrupted by addition of Factor H