IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Nop17 is a key R2TP factor for the assembly and maturation of box C/D snoRNP complex. Nop17 is a key R2TP factor for the assembly and maturation of box C/D snoRNP complex. BMC molecular biology 2014 imex curation Prieto MB., Georg RC., Gonzales-Zubiate FA., Luz JS., Oliveira CC. ccoliv@iq.usp.br 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom northern blot northern blot northen Prieto MB., Georg RC., Gonzales-Zubiate FA., Luz JS., Oliveira CC. ccoliv@iq.usp.br Accepted 2016-APR-25 AT 12:15 BST AT 12:15 BST by MGT BMC molecular biology 2014 Only protein-protein interactions imex curation imex curation Nop17 is a key R2TP factor for the assembly and maturation of box C/D snoRNP complex. Nop17 is a key R2TP factor for the assembly and maturation of box C/D snoRNP complex. BMC molecular biology 2014 imex curation Prieto MB., Georg RC., Gonzales-Zubiate FA., Luz JS., Oliveira CC. ccoliv@iq.usp.br 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast ch-ip chromatin immunoprecipitation assay ch-ip qrt-pcr quantitative reverse transcription pcr QRT-PCR Prieto MB., Georg RC., Gonzales-Zubiate FA., Luz JS., Oliveira CC. ccoliv@iq.usp.br Accepted 2016-APR-25 AT 12:15 BST AT 12:15 BST by MGT BMC molecular biology 2014 Only protein-protein interactions imex curation imex curation Nop17 is a key R2TP factor for the assembly and maturation of box C/D snoRNP complex. Nop17 is a key R2TP factor for the assembly and maturation of box C/D snoRNP complex. BMC molecular biology 2014 imex curation Prieto MB., Georg RC., Gonzales-Zubiate FA., Luz JS., Oliveira CC. ccoliv@iq.usp.br 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Prieto MB., Georg RC., Gonzales-Zubiate FA., Luz JS., Oliveira CC. ccoliv@iq.usp.br Accepted 2016-APR-25 AT 12:15 BST AT 12:15 BST by MGT BMC molecular biology 2014 Only protein-protein interactions imex curation imex curation Nop17 is a key R2TP factor for the assembly and maturation of box C/D snoRNP complex. Nop17 is a key R2TP factor for the assembly and maturation of box C/D snoRNP complex. BMC molecular biology 2014 imex curation Prieto MB., Georg RC., Gonzales-Zubiate FA., Luz JS., Oliveira CC. ccoliv@iq.usp.br 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Prieto MB., Georg RC., Gonzales-Zubiate FA., Luz JS., Oliveira CC. ccoliv@iq.usp.br Accepted 2016-APR-25 AT 12:15 BST AT 12:15 BST by MGT BMC molecular biology 2014 Only protein-protein interactions imex curation imex curation rrna 5s yeast Ribosomal RNA 5S yeast rrna ribosomal rna rRNA rrna yeast Saccharomyces cerevisiae Baker's yeast GGUUGCGGCCAUAUCUACCAGAAAGCACCGUUUCCCGUCCGAUCAACUGUAGUUAAGCUGGUAAGAGCCUGACCGAGUAGUGUAGUGGGUGACCAUACGCGAAACUCAGGUGCUGCAAUCU nop8_yeast 60S ribosome subunit biogenesis protein NOP8 YOL144W Nucleolar protein 8 NOP8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDSVIQKRIFVGNIFHNADDCYSELLDRFGKFGDCQDFQFEKHNHFAFIDIRFNDEADFNKLRKSFNNVKFKGNILKVDEAKPNWESTWAVQHAKDLKEDIILNAKMKKKNWQHYKKMENVAKSWKDHKEVIAGRMREAPRKRSQLRNITFRINVNGSLKVYKCYKTKLWGYERNKELNDLVYKFTNNFWKNGYNHIVDRLDYSRAVKTVRFKNGLKQLTVSKDENVCSGEMDSDENMSEEEKEKNNVILNDLLKDFDFDKPMTLNDSDEELLTEQRKGEEEEEEEEEKEVNAPEYENVNKTKDQSTLPQEKPEERKEQDEGDGQEDNEFIPTFTKEIGQGTISNTETLRNLFNPNEAEPVSQFKLIEDSDNDIDHAKDVDVNQLEEEVSKSSDTLGLTSAPVPHVSRDKDNKNFLFFPHLQSPFLVGQTQLSKVRAPGRETMLSNWDEEFWANRGNWTRDMRRKMKDALKHRKRKQSKSGLLL 30F291042433B208 fbrl_yeast rRNA 2'-O-methyltransferase fibrillarin NOP1 LOT3 YDL014W D2870 U3 small nucleolar RNA-associated protein NOP1 Histone-glutamine methyltransferase protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFRPGSRGGSRGGSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGRGGAAGGARGGAKVVIEPHRHAGVYIARGKEDLLVTKNMAPGESVYGEKRISVEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMGGLDELFIAPGKKVLYLGAASGTSVSHVSDVVGPEGVVYAVEFSHRPGRELISMAKKRPNIIPIIEDARHPQKYRMLIGMVDCVFADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTVDAETVFAREVQKLREERIKPLEQLTLEPYERDHCIVVGRYMRSGLKK 56A8B958A7B6066E 56A8B958A7B6066E snru3a yeast small nuclear RNA U3a Yeast snrna small nuclear rna snRNA snrna yeast Saccharomyces cerevisiae Baker's yeast GUCGACGUACUUCAGUAUGUAAUAUACCCCAAACAUUUUACCCACAAAAAACCAGGAUUUGAAAACUAUAGCAUCUAAAAGUCUUAGGUACUAGAGUUUUCAUUUCGGAGCAGGCUUUUUGAAAAAUUUAAUUCAACCAUUGCAGCAGCUUUUGACUAACACAUUCUACAGUAGGAUCAUUUCUAUAGGAAUCGUCACUCUUUGACUCUUCAAAAGAGCCACUGAAUCCAACUUGGUUGAUGAGUCCCAUAACCUUUGUACCCCAGAGUGAGAAACCGAAAUUGAAUCUAAAUUAGCUUGGUCCGCAAUCCUUAGCGGUUCGGCCAUCUAUAAUUUUGAAUAAAAAUUUUGCUUUGCCGUUGCAUUUGUAGUUUUUUCCUUUGGAAGUAAUUACAAUAUUUUAUGGCGCGAUGAUCUUGACCCAUCCUAUGUACUUCUUUUUUGAAGGGAUAGGGCUCUAUGGGUGGGUACAAAUGGCAGUCUGACAAGU rrp43_yeast Exosome complex component RRP43 RRP43 YCR035C YCR35C YCR522 Ribosomal RNA-processing protein 43 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAESTTLETIEIHPITFPPEVLARISPELSLQRHLSLGIRPCLRKYEEFRDVAIENNTLSRYADAGNIDTKNNILGSNVLKSGKTIVITSITGGIIEETSAAIKDLDDFGEEELFEVTKEEDIIANYASVYPVVEVERGRVGACTDEEMTISQKLHDSILHSRILPKKALKVKAGVRSANEDGTFSVLYPDELEDDTLNETNLKMKRKWSYVLYAKIVVLSRTGPVFDLCWNSLMYALQSVKLPRAFIDERASDLRMTIRTRGRSATIRETYEIICDQTKSVPLMINAKNIAFASNYGIVELDPECQLQNSDNSEEEEVDIDMDKLNTVLIADLDTEAEETSIHSTISILAAPSGNYKQLTLVGGGAKITPEMIKRSLLLSRVRADDLSTRFNI 8801837B8184134D 8801837B8184134D tah1_yeast TPR repeat-containing protein associated with Hsp90 YCR60W YCR060W TAH1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS 3738DE6F227F803A 3738DE6F227F803A nop58_yeast Nucleolar protein 58 Nucleolar protein 5 NOP58 NOP5 YOR310C O6108 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAYVLTETSAGYALLKASDKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAANALEEANSIIEGKVSSQLEKLLEEIKKDKKSTLIVSETKLANAINKLGLNFNVVSDAVTLDIYRAIKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASETDLSEILPEEIEERVKTAAEVSMGTEITQTDLDNINALAEQIVEFAAYREQLSNYLSARMKAIAPNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRLSQLEGRDLRTTPKVVREAKKVEMTEARAYNADADTAKAASDSESDSDDEEEEKKEKKEKKRKRDDDEDSKDSKKAKKEKKDKKEKKEKKEKKEKKEKKEKKEKKSKKEKKEKK 8A2889448B2A19E2 8A2889448B2A19E2 ruvb1_yeast RuvB-like protein 1 RVB1 TIP49-homology protein 1 TIP49a homolog TIH1 TIP49A YDR190C protein protein yeast Saccharomyces cerevisiae Baker's yeast MVAISEVKENPGVNSSNSGAVTRTAAHTHIKGLGLDESGVAKRVEGGFVGQIEAREACGVIVDLIKAKKMSGRAILLAGGPSTGKTALALAISQELGPKVPFCPLVGSELYSVEVKKTETLMENFRRAIGLRIKETKEVYEGEVTELTPEDAENPLGGYGKTISHVIVGLKSAKGTKTLRLDPTIYESIQREKVSIGDVIYIEANTGAVKRVGRSDAYATEFDLETEEYVPLPKGEVHKKKEIVQDVTLHDLDVANARPQGGQDVISMMGQLLKPKKTEITEKLRQEVNKVVAKYIDQGVAELIPGVLFIDEVNMLDIEIFTYLNKALESNIAPVVVLASNRGMTTVRGTEDVISPHGVPPDLIDRLLIVRTLPYDKDEIRTIIERRATVERLQVESSALDLLATMGTETSLRYALQLLAPCGILAQTSNRKEIVVNDVNEAKLLFLDAKRSTKILETSANYL 93D6ECB7006AF0F2 93D6ECB7006AF0F2 snu13_yeast 13 kDa ribonucleoprotein-associated protein YEL026W SNU13 Small nuclear ribonucleoprotein-associated protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI 4489780153E8F182 4489780153E8F182 ruvb2_yeast RuvB-like protein 2 TIP49-homology protein 2 TIP49b homolog RVB2 TIH2 TIP49B YPL235W P1060 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIQTSDPNETSDLKSLSLIAAHSHITGLGLDENLQPRPTSEGMVGQLQARRAAGVILKMVQNGTIAGRAVLVAGPPSTGKTALAMGVSQSLGKDVPFTAIAGSEIFSLELSKTEALTQAFRKSIGIKIKEETELIEGEVVEIQIDRSITGGHKQGKLTIKTTDMETIYELGNKMIDGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGADTRFVQCPEGELQKRKTVVHTVSLHEIDVINSRTQGFLALFTGDTGEIRSEVRDQINTKVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVMMATNRGVSKTRGTNYKSPHGLPLDLLDRSIIITTKSYNEQEIKTILSIRAQEEEVELSSDALDLLTKTGVETSLRYSSNLISVAQQIAMKRKNNTVEVEDVKRAYLLFLDSARSVKYVQENESQYIDDQGNVQISIAKSADPDAMDTTE 0D8EFBA7EC711AB8 0D8EFBA7EC711AB8 snr17a_yeast_gene gene gene yeast Saccharomyces cerevisiae Baker's yeast pih1_yeast Protein interacting with Hsp90 1 PIH1 NOP17 Nucleolar protein 17 YHR034C protein protein yeast Saccharomyces cerevisiae Baker's yeast MADFLLRPIKQRHRNEDKYVSVDAADGSVSKIEPIADFVIKTKLLSANGPEKLQDGRKVFINVCHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCINSDCSRWICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGAELPALEVLNDELHQDYKAKMHKIIEEEAGDPMSILRGRNDDGDDNNDPDDGTLPPLFPIENKISGAKIEEIDKNEIAHRNLKQAPAPAPAPHEQQEDVPEYEVKMKRFKGAAYKLRILIENKAPNSKPDRFSPSYNFAENILYINGKLSIPLPRDIVVNAADIKIFHIRKERTLYIYI 02C06D0A113B1B3B 02C06D0A113B1B3B nip7_yeast 60S ribosome subunit biogenesis protein NIP7 YPL211W NIP7 Nuclear import protein 7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MRQLTEEETKVVFEKLAGYIGRNISFLVDNKELPHVFRLQKDRVYYVPDHVAKLATSVARPNLMSLGICLGKFTKTGKFRLHITSLTVLAKHAKYKIWIKPNGEMPFLYGNHVLKAHVGKMSDDIPEHAGVIVFAMNDVPLGFGVSAKSTSESRNMQPTGIVAFRQADIGEYLRDEDTLFT 82EAE8E4B2FCC31A 82EAE8E4B2FCC31A pih1-rvb2-1 3 14 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association Fig 1 nip7-rrp43-3 3 9 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Fig 1A, C pih1-rvb1-4 3 12 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association Fig 1 A nip7-nop8-2 3 6 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Fig 1A, C rvb1-pih1-2 3 12 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association Fig 1A rvb2-rvb1-1 3 14 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Fig 1 A rvb1-rvb2-12 3 14 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Fig 1A pih1-rvb1-5 3 10 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait P38768:p.Asn306Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain N S Wed May 02 15:35:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn306ser' Tue Jun 30 18:01:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn306Ser' physical association physical association Fig 1 C nop17_rvb1-1 4 12 unspecified role unspecified role prey prey tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role bait bait tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig1B CHEBI:15422 -ATP CHEBI:16761 -ADP pih1-rvb2-2 4 14 unspecified role unspecified role prey prey tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role bait bait tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig1B nop58-9 1 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig 4, Fig 5B The interaction between U3 and Nop58 was increased in the presence of Nop17 snu13_nop1-1 4 7 unspecified role unspecified role prey prey tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig 6 A snu13-nop1-1 4 16 unspecified role unspecified role prey prey tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) association association Fig 6 A nop58_nop17-1 3 11 unspecified role unspecified role bait bait range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 16 unspecified role unspecified role prey prey physical association physical association Fig 5A nop58-10 2 15 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association fig4B