IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A secretory kinase complex regulates extracellular protein phosphorylation. A secretory kinase complex regulates extracellular protein phosphorylation. eLife 2014 imex curation Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE., Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE. The authors have confirmed that OPN and Casein are of Human origin; OPN has an N-terminal his-tag and was expressed in E.coli. the identity of the Casein used was Beta-casein -CSN2. They have also confirmed that the (E.coli expressed) AMTN construct is amino acids 17-209. jedixon@ucsd.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE., Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE. Dark Space = no42? The authors have confirmed that OPN and Casein are of Human origin; OPN has an N-terminal his-tag and was expressed in E.coli. the identity of the Casein used was Beta-casein -CSN2. They have also confirmed that the (E.coli expressed) AMTN construct is amino acids 17-209. jedixon@ucsd.edu Accepted 2016-AUG-02 AT 10:40 BST AT 10:40 BST by ORCHARD eLife 2014 imex curation A secretory kinase complex regulates extracellular protein phosphorylation. A secretory kinase complex regulates extracellular protein phosphorylation. eLife 2014 imex curation Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE., Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE. The authors have confirmed that OPN and Casein are of Human origin; OPN has an N-terminal his-tag and was expressed in E.coli. the identity of the Casein used was Beta-casein -CSN2. They have also confirmed that the (E.coli expressed) AMTN construct is amino acids 17-209. jedixon@ucsd.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions mouse-mammary gland Mus musculus mammary gland mammary_gland mammary gland anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE., Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE. Dark Space = no42? Golgi/ER-enriched fractions of the mouse lactating mammary gland. The authors have confirmed that OPN and Casein are of Human origin; OPN has an N-terminal his-tag and was expressed in E.coli. the identity of the Casein used was Beta-casein -CSN2. They have also confirmed that the (E.coli expressed) AMTN construct is amino acids 17-209. jedixon@ucsd.edu Accepted 2016-AUG-02 AT 10:40 BST AT 10:40 BST by ORCHARD eLife 2014 imex curation A secretory kinase complex regulates extracellular protein phosphorylation. A secretory kinase complex regulates extracellular protein phosphorylation. eLife 2014 imex curation Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE., Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE. The authors have confirmed that OPN and Casein are of Human origin; OPN has an N-terminal his-tag and was expressed in E.coli. the identity of the Casein used was Beta-casein -CSN2. They have also confirmed that the (E.coli expressed) AMTN construct is amino acids 17-209. jedixon@ucsd.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE., Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE. Dark Space = no42? The authors have confirmed that OPN and Casein are of Human origin; OPN has an N-terminal his-tag and was expressed in E.coli. the identity of the Casein used was Beta-casein -CSN2. They have also confirmed that the (E.coli expressed) AMTN construct is amino acids 17-209. jedixon@ucsd.edu Accepted 2016-AUG-02 AT 10:40 BST AT 10:40 BST by ORCHARD eLife 2014 imex curation A secretory kinase complex regulates extracellular protein phosphorylation. A secretory kinase complex regulates extracellular protein phosphorylation. eLife 2014 imex curation Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE., Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE. The authors have confirmed that OPN and Casein are of Human origin; OPN has an N-terminal his-tag and was expressed in E.coli. the identity of the Casein used was Beta-casein -CSN2. They have also confirmed that the (E.coli expressed) AMTN construct is amino acids 17-209. jedixon@ucsd.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE., Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE. Dark Space = no42? The authors have confirmed that OPN and Casein are of Human origin; OPN has an N-terminal his-tag and was expressed in E.coli. the identity of the Casein used was Beta-casein -CSN2. They have also confirmed that the (E.coli expressed) AMTN construct is amino acids 17-209. jedixon@ucsd.edu Accepted 2016-AUG-02 AT 10:40 BST AT 10:40 BST by ORCHARD eLife 2014 imex curation A secretory kinase complex regulates extracellular protein phosphorylation. A secretory kinase complex regulates extracellular protein phosphorylation. eLife 2014 imex curation Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE., Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE. The authors have confirmed that OPN and Casein are of Human origin; OPN has an N-terminal his-tag and was expressed in E.coli. the identity of the Casein used was Beta-casein -CSN2. They have also confirmed that the (E.coli expressed) AMTN construct is amino acids 17-209. jedixon@ucsd.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE., Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE. (EBI-11893197) I have altered the FAM20C mutation to "decreasing" and when you look at the feature this is what is shown. However it still displays as "increasing", even after logging out/in. However after log/out and realtering it did eventually stay as "decreasing". Dark Space = no42? The authors have confirmed that OPN and Casein are of Human origin; OPN has an N-terminal his-tag and was expressed in E.coli. the identity of the Casein used was Beta-casein -CSN2. They have also confirmed that the (E.coli expressed) AMTN construct is amino acids 17-209. jedixon@ucsd.edu Accepted 2016-AUG-02 AT 10:40 BST AT 10:40 BST by ORCHARD eLife 2014 imex curation A secretory kinase complex regulates extracellular protein phosphorylation. A secretory kinase complex regulates extracellular protein phosphorylation. eLife 2014 imex curation Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE., Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE. The authors have confirmed that OPN and Casein are of Human origin; OPN has an N-terminal his-tag and was expressed in E.coli. the identity of the Casein used was Beta-casein -CSN2. They have also confirmed that the (E.coli expressed) AMTN construct is amino acids 17-209. jedixon@ucsd.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro thermal shift thermal shift binding thermal shift predetermined predetermined participant predetermined Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE., Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE. Dark Space = no42? Protein thermal stability was monitored by the fluorescence generated from binding of the dye SYPRO Orange to the hydrophobic region exposed upon protein denaturation. The authors have confirmed that OPN and Casein are of Human origin; OPN has an N-terminal his-tag and was expressed in E.coli. the identity of the Casein used was Beta-casein -CSN2. They have also confirmed that the (E.coli expressed) AMTN construct is amino acids 17-209. jedixon@ucsd.edu Accepted 2016-AUG-02 AT 10:40 BST AT 10:40 BST by ORCHARD eLife 2014 imex curation A secretory kinase complex regulates extracellular protein phosphorylation. A secretory kinase complex regulates extracellular protein phosphorylation. eLife 2014 imex curation Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE., Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE. The authors have confirmed that OPN and Casein are of Human origin; OPN has an N-terminal his-tag and was expressed in E.coli. the identity of the Casein used was Beta-casein -CSN2. They have also confirmed that the (E.coli expressed) AMTN construct is amino acids 17-209. jedixon@ucsd.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE., Cui J., Xiao J., Tagliabracci VS., Wen J., Rahdar M., Dixon JE. Dark Space = no42? The release of inorganic phosphate ions are monitored by the change in absorbance at 620nm due to formation of a phosphomolybdate–malachite green complex. The authors have confirmed that OPN and Casein are of Human origin; OPN has an N-terminal his-tag and was expressed in E.coli. the identity of the Casein used was Beta-casein -CSN2. They have also confirmed that the (E.coli expressed) AMTN construct is amino acids 17-209. jedixon@ucsd.edu Accepted 2016-AUG-02 AT 10:40 BST AT 10:40 BST by ORCHARD eLife 2014 imex curation pgs2_human Decorin DCN SLRR1B Bone proteoglycan II PG-S2 PG40 protein protein human Homo sapiens Human MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK FF511E871A1A52DD p10451-pro_0000020321 Osteopontin SPP1 BNSP OPN Bone sialoprotein 1 Nephropontin Secreted phosphoprotein 1 Urinary stone protein Uropontin PSEC0156 protein protein human Homo sapiens Human IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN 17 314 D74C68520DA9D157 p05814-pro_0000004475 Beta-casein CSN2 CASB protein protein human Homo sapiens Human RETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV 16 226 1C2D30D307D2CA3E fa20c_human Extracellular serine/threonine protein kinase FAM20C Dentin matrix protein 4 Golgi-enriched fraction casein kinase FAM20C DMP4 Golgi casein kinase protein protein human Homo sapiens Human MKMMLVRRFRVLILMVFLVACALHIALDLLPRLERRGARPSGEPGCSCAQPAAEVAAPGWAQVRGRPGEPPAASSAAGDAGWPNKHTLRILQDFSSDPSSNLSSHSLEKLPPAAEPAERALRGRDPGALRPHDPAHRPLLRDPGPRRSESPPGPGGDASLLARLFEHPLYRVAVPPLTEEDVLFNVNSDTRLSPKAAENPDWPHAGAEGAEFLSPGEAAVDSYPNWLKFHIGINRYELYSRHNPAIEALLHDLSSQRITSVAMKSGGTQLKLIMTFQNYGQALFKPMKQTREQETPPDFFYFSDYERHNAEIAAFHLDRILDFRRVPPVAGRMVNMTKEIRDVTRDKKLWRTFFISPANNICFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSYHKRKKAEWEVDPDYCEEVKQTPPYDSSHRILDVMDMTIFDFLMGNMDRHHYETFEKFGNETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEYKLSLLMAESLRGDQVAPVLYQPHLEALDRRLRVVLKAVRDCVERNGLHSVVDDDLDTEHRAASAR Calcium-binding protein which may play a role in dentin mineralization Defects in FAM20C are the cause of Raine syndrome (RNS) [MIM:259775]. RNS is an autosomal recessive osteosclerotic bone dysplasia with neonatal lethal outcome. Clinical features include generalized osteosclerosis, craniofacial dysplasia and microcephaly mint homomint ECD278B5EA681FEF amtn_human Amelotin AMTN UNQ689/PRO1329 protein protein human Homo sapiens Human MRSTILLFCLLGSTRSLPQLKPALGLPPTKLAPDQGTLPNQQQSNQVFPSLSLIPLTQMLTLGPDLHLLNPAAGMTPGTQTHPLTLGGLNVQQQLHPHVLPIFVTQLGAQGTILSSEELPQIFTSLIIHSLFPGGILPTSQAGANPDVQDGSLPAGGAGVNPATQGTPAGRLPTPSGTDDDFAVTTPAGIQRSTHAIEEATTESANGIQ 5DD8991674DB8457 enam_human Enamelin ENAM protein protein human Homo sapiens Human MLVLRCRLGTSFPKLDNLVPKGKMKILLVFLGLLGNSVAMPMHMPRMPGFSSKSEEMMRYNQFNFMNGPHMAHLGPFFGNGLPQQFPQYQMPMWPQPPPNTWHPRKSSAPKRHNKTDQTQETQKPNQTQSKKPPQKRPLKQPSHNQPQPEEEAQPPQAFPPFGNGLFPYQQPPWQIPQRLPPPGYGRPPISNEEGGNPYFGYFGYHGFGGRPPYYSEEMFEQDFEKPKEEDPPKAESPGTEPTANSTVTETNSTQPNPKGSQGGNDTSPTGNSTPGLNTGNNPPAQNGIGPLPAVNASGQGGPGSQIPWRPSQPNIRENHPYPNIRNFPSGRQWYFTGTVMGHRQNRPFYRNQQVQRGPRWNFFAWERKQVARPGNPVYHKAYPPTSRGNYPNYAGNPANLRRKPQGPNKHPVGTTVAPLGPKPGPVVRNEKIQNPKEKPLGPKEQIIVPTKNPTSPWRNSQQYEVNKSNYKLPHSEGYMPVPNFNSVDQHENSYYPRGDSRKVPNSDGQTQSQNLPKGIVLGSRRMPYESETNQSELKHSSYQPAVYPEEIPSPAKEHFPAGRNTWDHQEISPPFKEDPGRQEEHLPHPSHGSRGSVFYPEYNPYDPRENSPYLRGNTWDERDDSPNTMGQKESPLYPINTPDQKEIVPYNEEDPVDPTGDEVFPGQNRWGEELSFKGGPTVRHYEGEQYTSNQPKEYLPYSLDNPSKPREDFYYSEFYPWSPDENFPSYNTASTMPPPIESRGYYVNNAAGPEESTLFPSRNSWDHRIQAQGQRERRPYFNRNIWDQATHLQKAPARPPDQKGNQPYYSNTPAGLQKNPIWHEGENLNYGMQITRMNSPEREHSSFPNFIPPSYPSGQKEAHLFHLSQRGSCCAGSSTGPKDNPLALQDYTPSYGLAPGENQDTSPLYTDGSHTKQTRDIISPTSILPGQRNSSEKRESQNPFRDDVSTLRRNTPCSIKNQLGQKEIMPFPEASSLQSKNTPCLKNDLGGDGNNILEQVFEDNQLNERTVDLTPEQLVIGTPDEGSNPEGIQSQVQENESERQQQRPSNILHLPCFGSKLAKHHSSTTGTPSSDGRQSPFDGDSITPTENPNTLVELATEEQFKSINVDPLDADEHSPFEFLQRGTNVQDQVQDCLLLQA 28274A71BE947EB1 atp ATP Adenosine 5'-triphosphate Adenosine triphosphate ADENOSINE-5'-TRIPHOSPHATE Adephos Adetol Adynol Atipi ATP Atriphos Cardenosine Fosfobion Glucobasin H4atp Myotriphos Triadenyl Triphosphaden adenosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ambn_human Ameloblastin AMBN protein protein human Homo sapiens Human MSASKIPLFKMKDLILILCLLEMSFAVPFFPQQSGTPGMASLSLETMRQLGSLQRLNTLSQYSRYGFGKSFNSLWMHGLLPPHSSLPWMRPREHETQQYEYSLPVHPPPLPSQPSLKPQQPGLKPFLQSAAATTNQATALKEALQPPIHLGHLPLQEGELPLVQQQVAPSDKPPKPELPGVDFADPQGPSLPGMDFPDPQGPSLPGLDFADPQGSTIFQIARLISHGPMPQNKQSPLYPGMLYVPFGANQLNAPARLGIMSSEEVAGGREDPMAYGAMFPGFGGMRPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDNLENPAFLTELEPAPHAGLLALPKDDIPGLPRSPSGKMKGLPSVTPAAADPLMTPELADVYRTYDADMTTSVDFQEEATMDTTMAPNSLQTSMPGNKAQEPEMMHDAWHFQEP D5CAFAA76B55758C q99217-pro_0000001199 Amelogenin, X isoform AMELX AMG AMGX protein protein human Homo sapiens Human MPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD 17 191 57C2BAA88D44E5C1 fa20a_mouse Pseudokinase FAM20A Fam20a protein protein mouse Mus musculus Mouse MPGLRRDRLLALLLLGALFSADLYFHLWPQVQRQLRPGERPAACPCSGRAPSASLHSAAASRDLGTASHNFSGALPRVEHPSRGHPAPRSKLQALFAHSLYQVLEDPPLLGPEDWLLASQEALRYYRRKVARWNRRHKIYKEQFNLTSLDPPLQFRPEASWVQFHLGINSHGLYSRSSLAISKLLHDMRHFPTISADYSQDEKALLGACDCSQIVKPSGVHLKLVLRFSDFGKAMFKPMRQQREEETPEDFFYFIDFQRHNAEIAAFHLDRILDFRRVPPTVGRLVNVTKEILEVTKNEILQSVFFVSPANNVCFFAKCPYMCKTEYAVCGNPHLLEGSLSAFLPSLNLAPRLSVPNPWIRSYSLSGKEEWELNPLYCDTVKQIYPYNSSNRLLGIIDMAVFDFLIGNMDRHHYEMFTKFGDDGYLIHLDNARGFGRHSQDEISILAPLAQCCMIKRKTLLHLQLLAQADYRLSDVMRESLLEDQLSPVLTEPHLLALDRRLQIILKTVEDCIEAHGERRVIAEGSAQRSAPDSGQANLTS 2F6B2DCF9A447CDA fa20c_mouse Extracellular serine/threonine protein kinase FAM20C Fam20c Dmp4 Kiaa4081 Dentin matrix protein 4 Golgi-enriched fraction casein kinase protein protein mouse Mus musculus Mouse MKMILVRRFRVLILVVFLLACALHIAVDLLPKLDRRATRSSGEPGCSCAQPAAEAAGPGWAQARSRPGESAGGDAGWPNKHTLRILQDFSSDPASNLTSHSLEKLPSAAEPVDHAPRGQEPRSPPPRDPAHRPLLRDPGPRPRVPPPGPSGDGSLLAKLFEHPLYQGAVPPLTEDDVLFNVNSDIRFNPKAAENPDWPHEGAEGAEFLPTGEAAVNLYPNWLKFHIGINRYELYSRHNPAIDALLRDLGSQKITSVAMKSGGTQLKLIMTFQNYGQALFKPMKQTREQETPPDFFYFSDYERHNAEIAAFHLDRILDFRRVPPVAGRMINMTKEIRDVTRDKKLWRTFFVSPANNICFYGECSYYCSTEHALCGRPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSYHKRKKAEWEVDPDYCEEVKQTPPYDSGHRILDIMDMTVFDFLMGNMDRHHYETFEKFGNETFIIHLDNGRGFGKYSHDELSILAPLHQCCRIRRSTYLRLQLLAKEEHKLSLLMAESLQHDKVAPVLYQLHLEALDRRLRIVLQAVRDCVEKDGLSSVVEDDLATEHRASTER 9DE5F5496AC117FE xylk_human Glycosaminoglycan xylosylkinase FAM20B KIAA0475 Xylose kinase protein protein human Homo sapiens Human MKLKQRVVLLAILLVIFIFTKVFLIDNLDTSAANREDQRAFHRMMTGLRVELAPKLDHTLQSPWEIAAQWVVPREVYPEETPELGAVMHAMATKKIIKADVGYKGTQLKALLILEGGQKVVFKPKRYSRDHVVEGEPYAGYDRHNAEVAAFHLDRILGFHRAPLVVGRFVNLRTEIKPVATEQLLSTFLTVGNNTCFYGKCYYCRETEPACADGDIMEGSVTLWLPDVWPLQKHRHPWGRTYREGKLARWEYDESYCDAVKKTSPYDSGPRLLDIIDTAVFDYLIGNADRHHYESFQDDEGASMLILLDNAKSFGNPSLDERSILAPLYQCCIIRVSTWNRLNYLKNGVLKSALKSAMAHDPISPVLSDPHLDAVDQRLLSVLATVKQCTDQFGMDTVLVEDRMPLSHL 03E211C0AF37B766 fa20a_human Pseudokinase FAM20A FAM20A UNQ9388/PRO34279 protein protein human Homo sapiens Human MPGLRRDRLLTLLLLGALLSADLYFHLWPQVQRQLRPRERPRGCPCTGRASSLARDSAAAASDPGTIVHNFSRTEPRTEPAGGSHSGSSSKLQALFAHPLYNVPEEPPLLGAEDSLLASQEALRYYRRKVARWNRRHKMYREQMNLTSLDPPLQLRLEASWVQFHLGINRHGLYSRSSPVVSKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDFGKAMFKPMRQQRDEETPVDFFYFIDFQRHNAEIAAFHLDRILDFRRVPPTVGRIVNVTKEILEVTKNEILQSVFFVSPASNVCFFAKCPYMCKTEYAVCGNPHLLEGSLSAFLPSLNLAPRLSVPNPWIRSYTLAGKEEWEVNPLYCDTVKQIYPYNNSQRLLNVIDMAIFDFLIGNMDRHHYEMFTKFGDDGFLIHLDNARGFGRHSHDEISILSPLSQCCMIKKKTLLHLQLLAQADYRLSDVMRESLLEDQLSPVLTEPHLLALDRRLQTILRTVEGCIVAHGQQSVIVDGPVEQLAPDSGQANLTS B44A4655996279A1 enam-fam20c-1 5 11 enzyme enzyme neutral component neutral component Q8IXL6:p.Asp478Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain D A Wed May 02 16:02:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp478ala' Tue Jun 30 16:56:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp478Ala' Q8IXL6:p.Glu306Gln mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain E Q Wed May 02 15:40:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu306gln' Tue Jun 30 17:03:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu306Gln' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 13 enzyme target enzyme target substrate substrate neutral component neutral component Q9NRM1:p.Ser191Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:47:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser191ala' Tue Jun 30 16:55:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser191Ala' Q9NRM1:p.Ser216Leu mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain S L Wed May 02 17:13:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser216leu' Tue Jun 30 18:57:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser216Leu' region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9NRM1:p.[Ser191Ala;Ser216Leu] mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S L Wed May 02 18:15:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser191ala,ser216leu' Tue Jun 30 19:06:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser191Ala;Ser216Leu]' ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 1 A/B, Figure 2—figure supplement 2, 4 A/B/D/G, 5F amtn-fam20c-3 5 11 enzyme enzyme neutral component neutral component Q8IXL6:p.Asp478Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain D A Wed May 02 15:39:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp478ala' Tue Jun 30 17:17:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp478Ala' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 12 enzyme target enzyme target substrate substrate neutral component neutral component region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 1 A, 4A AMTN is stated to be aas 17–219, but the molecule only has 209 residues. amtn-fam20c-1 5 11 enzyme enzyme neutral component neutral component Q8IXL6:p.Asp478Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain D A Wed May 02 17:43:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp478ala' Tue Jun 30 17:43:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp478Ala' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 16 enzyme target enzyme target substrate substrate neutral component neutral component region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 1 Ai atp-fam20c-1 7 11 enzyme enzyme neutral component neutral component Q8IXL6:p.Asp478Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain D A Wed May 02 16:33:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp478ala' Tue Jun 30 20:11:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp478Ala' Q8IXL6:p.Glu306Gln mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain E Q Wed May 02 18:29:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu306gln' Tue Jun 30 15:46:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu306Gln' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 14 enzyme target enzyme target substrate substrate neutral component neutral component atpase reaction atpase reaction 2 A/E atp-fam20c-2 6 11 unspecified role unspecified role bait bait trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 14 unspecified role unspecified role prey prey direct interaction direct interaction 2B fam20c-atp-1 6 14 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction 2Bi Fam20A can bind, but not hydrolyze ATP. atp-fam20c-3 7 14 enzyme target enzyme target substrate substrate neutral component neutral component 20 enzyme enzyme neutral component neutral component Q96MK3:p.Gln258Glu mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain Q E Wed May 02 17:34:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln258glu' Tue Jun 30 18:13:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln258Glu' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. atpase reaction atpase reaction 2 E amtn-fam20c-2 5 9 enzyme target enzyme target substrate substrate neutral component neutral component region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 20 enzyme enzyme neutral component neutral component Q96MK3:p.Gln258Glu mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain Q E Wed May 02 19:17:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln258glu' Tue Jun 30 20:03:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln258Glu' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. phosphorylation phosphorylation reaction phosphorylation 2F, Figure 4—figure supplement 3 fam20a-spp1-1 5 11 enzyme enzyme neutral component neutral component Q8IXL6:p.Glu306Gln mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain E Q Wed May 02 17:17:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu306gln' Tue Jun 30 18:06:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu306Gln' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 9 enzyme target enzyme target substrate substrate neutral component neutral component region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Figure2—figure supplement 2 enam-fam20c-2 5 11 enzyme enzyme neutral component neutral component trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 20 stimulator stimulator neutral component neutral component Q96MK3:p.Asp430Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain D A Wed May 02 15:37:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp430ala' Tue Jun 30 18:38:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp430Ala' Q96MK3:p.Gln258Glu mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain Q E Wed May 02 19:59:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln258glu' Tue Jun 30 19:52:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln258Glu' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 13 enzyme target enzyme target substrate substrate neutral component neutral component Q9NRM1:p.Ser191Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Wed May 02 14:50:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser191ala' Tue Jun 30 16:59:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser191Ala' Q9NRM1:p.[Ser191Ala;Ser216Leu] mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S L Wed May 02 18:08:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser191ala,ser216leu' Tue Jun 30 17:54:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser191Ala;Ser216Leu]' Q9NRM1:p.Ser216Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S L Wed May 02 14:58:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser216leu' Tue Jun 30 18:32:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser216Leu' region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 4 A/B/D/E/G, 5F, Figure 4—figure supplement 2, Figure 5—figure supplement 1. amtn-fam20c-4 5 11 enzyme enzyme neutral component neutral component trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 20 stimulator stimulator neutral component neutral component trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 12 enzyme target enzyme target substrate substrate neutral component neutral component region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 4A AMTN is stated to be aas 17–219, but the molecule only has 209 residues. fam20b-spp1-1 5 8 enzyme target enzyme target substrate substrate neutral component neutral component region glycores glycosylated residue GlycoRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined observed-ptm observed-ptm observed ptm observed-ptm region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 19 enzyme enzyme neutral component neutral component human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. phosphorylation phosphorylation reaction phosphorylation 4C Both proteins were not further purified after IP and Flag peptide elution. However the preparation appears relatively pure - only two faint unidentified bands can be seen on the Coomassie gel. fam20a-fam20c-2 3 11 unspecified role unspecified role neutral component neutral component trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 20 unspecified role unspecified role neutral component neutral component trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction 5A fam20a-fam20c-1 1 11 unspecified role unspecified role prey prey c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 20 unspecified role unspecified role bait bait c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 5C fam20a-fam20a-1 1 20 unspecified role unspecified role prey prey c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 20 unspecified role unspecified role bait bait c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 5D fam20a-fam20c-3 4 11 unspecified role unspecified role neutral component neutral component trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 20 unspecified role unspecified role neutral component neutral component trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction 5E fam20c-fam20a-1 2 18 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association 6D ambn-fam20a-1 5 11 enzyme enzyme neutral component neutral component Q8IXL6:p.Asp478Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain D A Wed May 02 17:16:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp478ala' Tue Jun 30 16:01:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp478Ala' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 15 enzyme target enzyme target substrate substrate neutral component neutral component Q9NP70:p.Ser43Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain S A Wed May 02 14:58:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser43ala' Tue Jun 30 17:14:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser43Ala' Q9NP70:p.Thr46Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:26:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr46ala' Tue Jun 30 18:17:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr46Ala' Q9NP70:p.Thr36Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:05:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr36ala' Tue Jun 30 20:09:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr36Ala' region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm sumo_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9NP70:p.Ser34Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:48:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser34ala' Tue Jun 30 16:42:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser34Ala' Q9NP70:p.Ser41Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:39:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser41ala' Tue Jun 30 18:23:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser41Ala' ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Figure 4—figure supplement 1. ambn-fam20c-1 5 11 enzyme enzyme neutral component neutral component Q8IXL6:p.Asp478Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain D A Wed May 02 17:02:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp478ala' Tue Jun 30 17:38:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp478Ala' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 20 stimulator stimulator neutral component neutral component trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 15 enzyme target enzyme target substrate substrate neutral component neutral component Q9NP70:p.Ser43Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:36:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser43ala' Tue Jun 30 17:38:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser43Ala' Q9NP70:p.Thr46Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T A Wed May 02 16:38:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr46ala' Tue Jun 30 20:02:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr46Ala' Q9NP70:p.Thr36Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T A Wed May 02 19:54:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr36ala' Tue Jun 30 15:37:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr36Ala' region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm sumo_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9NP70:p.Ser34Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:52:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser34ala' Tue Jun 30 16:11:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser34Ala' Q9NP70:p.Ser41Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:01:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser41ala' Tue Jun 30 20:25:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser41Ala' ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 4A, Figure 4—figure supplement 1. fam20c-spp1-1 5 11 enzyme enzyme neutral component neutral component Q8IXL6:p.Glu306Gln mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain E Q Wed May 02 18:15:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu306gln' Tue Jun 30 17:30:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu306Gln' trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 10 enzyme target enzyme target substrate substrate neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Figure2—figure supplement 2i