HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Identification of a Haemophilus influenzae factor H-Binding lipoprotein involved in serum resistance. Identification of a Haemophilus influenzae factor H-Binding lipoprotein involved in serum resistance. Journal of immunology (Baltimore, Md. : 1950) 2014 imex curation Fleury C., Su YC., Hallström T., Sandblad L., Zipfel PF., Riesbeck K., Fleury C., Su YC., Hallström T., Sandblad L., Zipfel PF., Riesbeck K. The two PH proteins (strains Hib 541 and Hif KR494) were identified as E1X6C6 (loci HIB_11110 in Hib 10810) and A0A024A2C9 (from HifGL_000598) respectively. (UPI000392B7AB entry has an identical sequence to A0A024A2C9, as HifGL_000598 has no current entry in UniProt.) kristian.riesbeck@med.lu.se 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Fleury C., Su YC., Hallström T., Sandblad L., Zipfel PF., Riesbeck K., Fleury C., Su YC., Hallström T., Sandblad L., Zipfel PF., Riesbeck K. The two PH proteins (strains Hib 541 and Hif KR494) were identified as E1X6C6 (loci HIB_11110 in Hib 10810) and A0A024A2C9 (from HifGL_000598) respectively. (UPI000392B7AB entry has an identical sequence to A0A024A2C9, as HifGL_000598 has no current entry in UniProt.) kristian.riesbeck@med.lu.se Accepted 2016-DEC-08 AT 15:22 GMT AT 15:22 GMT by MGT Journal of immunology (Baltimore, Md. : 1950) 2014 imex curation Identification of a Haemophilus influenzae factor H-Binding lipoprotein involved in serum resistance. Identification of a Haemophilus influenzae factor H-Binding lipoprotein involved in serum resistance. Journal of immunology (Baltimore, Md. : 1950) 2014 imex curation Fleury C., Su YC., Hallström T., Sandblad L., Zipfel PF., Riesbeck K., Fleury C., Su YC., Hallström T., Sandblad L., Zipfel PF., Riesbeck K. The two PH proteins (strains Hib 541 and Hif KR494) were identified as E1X6C6 (loci HIB_11110 in Hib 10810) and A0A024A2C9 (from HifGL_000598) respectively. (UPI000392B7AB entry has an identical sequence to A0A024A2C9, as HifGL_000598 has no current entry in UniProt.) kristian.riesbeck@med.lu.se 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting ms participant Identification by mass spectrometry ms participant Fleury C., Su YC., Hallström T., Sandblad L., Zipfel PF., Riesbeck K., Fleury C., Su YC., Hallström T., Sandblad L., Zipfel PF., Riesbeck K. The two PH proteins (strains Hib 541 and Hif KR494) were identified as E1X6C6 (loci HIB_11110 in Hib 10810) and A0A024A2C9 (from HifGL_000598) respectively. (UPI000392B7AB entry has an identical sequence to A0A024A2C9, as HifGL_000598 has no current entry in UniProt.) kristian.riesbeck@med.lu.se Accepted 2016-DEC-08 AT 15:22 GMT AT 15:22 GMT by MGT Journal of immunology (Baltimore, Md. : 1950) 2014 imex curation Identification of a Haemophilus influenzae factor H-Binding lipoprotein involved in serum resistance. Identification of a Haemophilus influenzae factor H-Binding lipoprotein involved in serum resistance. Journal of immunology (Baltimore, Md. : 1950) 2014 imex curation Fleury C., Su YC., Hallström T., Sandblad L., Zipfel PF., Riesbeck K., Fleury C., Su YC., Hallström T., Sandblad L., Zipfel PF., Riesbeck K. The two PH proteins (strains Hib 541 and Hif KR494) were identified as E1X6C6 (loci HIB_11110 in Hib 10810) and A0A024A2C9 (from HifGL_000598) respectively. (UPI000392B7AB entry has an identical sequence to A0A024A2C9, as HifGL_000598 has no current entry in UniProt.) kristian.riesbeck@med.lu.se 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Fleury C., Su YC., Hallström T., Sandblad L., Zipfel PF., Riesbeck K., Fleury C., Su YC., Hallström T., Sandblad L., Zipfel PF., Riesbeck K. The two PH proteins (strains Hib 541 and Hif KR494) were identified as E1X6C6 (loci HIB_11110 in Hib 10810) and A0A024A2C9 (from HifGL_000598) respectively. (UPI000392B7AB entry has an identical sequence to A0A024A2C9, as HifGL_000598 has no current entry in UniProt.) kristian.riesbeck@med.lu.se Accepted 2016-DEC-08 AT 15:22 GMT AT 15:22 GMT by MGT Journal of immunology (Baltimore, Md. : 1950) 2014 imex curation e1x6c6_haei1 HIB_11110 protein protein Haemophilus influenzae (strain 10810) Haemophilus influenzae (strain 10810) MKLNLSKFSLTILTTVMLASCGSGGGDNTQLVSPPKPAEQSKPAEQSKPADQSKSVEQSILGMPERLPTNTGLAFSIKTEDEGNINTIKNEQELIATNNFASINVDGKNIPIDFKLEPSQGWTKEGAFIEELNLAPHICCGKYTDVRFGAIASHSFGQDDILFYNGNPSNSVPESGEVTYKGESIMADKGNSVFGGYRKGTSEFKVNFGDKKLSGSLNVDSPKYDVESGESKFNKVKVDINADISGNKFYGSAKSSSFVSEAVSEGKFYGDGAKELGGMVKAKDNSWVGAYGAKAQ The sequence has been withdrawn from uniprot. 61023F9A209BF485 cfah_human Complement factor H CFH HF HF1 HF2 H factor 1 protein protein human Homo sapiens Human MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR DIP protein P08603 original sequence version: 161 DIP protein P08603-1 original sequence version: 149 3C26D62A2BF9BFEE a0a024a2c9_haeif lph tbp2 ERS515280_00355 protein protein haeif Haemophilus influenzae MNINLKKFSLTILAALTLTACGSGSGASASNAPTAQPSTPATQPSEQAVLEMPKRSPTNTGLVFSIKTESEEDSVGQINTINNEQELSNRTLTSIDVDGKQIPIAFTENWNEAKYIEQPLNGVPHICCNKYTAMRFGAIASNEAGQNDILFYNGIPTEKLPDSGEVTYEGESIMTSKESVIPDDYMKGSSKFIVNFGDKKLSGSLIIDTTKSTSSSQKVKIDIEKAKITGNTFSGTAQSDSFKSQGIAEGKFYGDGAKELGGMVKAKDNSWAGAYGAKAQ 78C3AE0668651BB4 p08603-2 Complement factor H CFH HF HF1 HF2 FHL-1 H factor 1 protein protein human Homo sapiens Human MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL C2AAD47F155343E3 ph-fh-1 2 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey partially purified partially purified physical association physical association 1A-2 lph-cfh-3 3 5 unspecified role unspecified role prey prey SCR_domains_18-20 sufficient to bind sufficient binding region sufficient to bind range range range range 6 unspecified role unspecified role bait bait c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 5C lph-cfh-4 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey c terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A lph-cfh-2 3 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 5B cfh-lph-1 2 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey partially purified partially purified physical association physical association 1A-1 cfh-lph-2 1 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey c terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 5Ai lph-cfh-5 3 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 5Bi lph-cfh-6 3 7 unspecified role unspecified role prey prey SCR_domains_1-7 sufficient to bind sufficient binding region sufficient to bind range range range range 6 unspecified role unspecified role bait bait c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 5Cii SCRs 1-7 bind weakly lph-cfh-7 3 5 unspecified role unspecified role prey prey SCR_domains_18-20 sufficient to bind sufficient binding region sufficient to bind range range range range 4 unspecified role unspecified role bait bait c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 5Ci lph-cfh-8 3 7 unspecified role unspecified role prey prey SCR_domains_1-7 sufficient to bind sufficient binding region sufficient to bind range range range range 4 unspecified role unspecified role bait bait c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 5Ciii SCRs 1-7 bind weakly