IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Angiogenin interacts with the plasminogen activation system at the cell surface of breast cancer cells to regulate plasmin formation and cell migration. Angiogenin interacts with the plasminogen activation system at the cell surface of breast cancer cells to regulate plasmin formation and cell migration. Molecular oncology 2014 imex curation Dutta S., Bandyopadhyay C., Bottero V., Veettil MV., Wilson L., Pins MR., Johnson KE., Warshall C., Chandran B. "rANG" is of Human origin - see Sadagopan et al., 2009. sujoy.dutta@rosalindfranklin.edu 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-t47d-a18 ER- and PR-positive hormone-responsive clone of t47d t47d-a18 ER- and PR-positive hormone-responsive clone of t47d fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Dutta S., Bandyopadhyay C., Bottero V., Veettil MV., Wilson L., Pins MR., Johnson KE., Warshall C., Chandran B. "rANG" is of Human origin - see Sadagopan et al., 2009. sujoy.dutta@rosalindfranklin.edu Accepted 2016-SEP-09 AT 16:22 BST AT 16:22 BST by ORCHARD Molecular oncology 2014 Only protein-protein interactions imex curation imex curation Angiogenin interacts with the plasminogen activation system at the cell surface of breast cancer cells to regulate plasmin formation and cell migration. Angiogenin interacts with the plasminogen activation system at the cell surface of breast cancer cells to regulate plasmin formation and cell migration. Molecular oncology 2014 imex curation Dutta S., Bandyopadhyay C., Bottero V., Veettil MV., Wilson L., Pins MR., Johnson KE., Warshall C., Chandran B. "rANG" is of Human origin - see Sadagopan et al., 2009. sujoy.dutta@rosalindfranklin.edu 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-t47d-a18 ER- and PR-positive hormone-responsive clone of t47d t47d-a18 ER- and PR-positive hormone-responsive clone of t47d pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Dutta S., Bandyopadhyay C., Bottero V., Veettil MV., Wilson L., Pins MR., Johnson KE., Warshall C., Chandran B. "rANG" is of Human origin - see Sadagopan et al., 2009. sujoy.dutta@rosalindfranklin.edu Accepted 2016-SEP-09 AT 16:22 BST AT 16:22 BST by ORCHARD Molecular oncology 2014 Only protein-protein interactions imex curation imex curation Angiogenin interacts with the plasminogen activation system at the cell surface of breast cancer cells to regulate plasmin formation and cell migration. Angiogenin interacts with the plasminogen activation system at the cell surface of breast cancer cells to regulate plasmin formation and cell migration. Molecular oncology 2014 imex curation Dutta S., Bandyopadhyay C., Bottero V., Veettil MV., Wilson L., Pins MR., Johnson KE., Warshall C., Chandran B. "rANG" is of Human origin - see Sadagopan et al., 2009. sujoy.dutta@rosalindfranklin.edu 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dutta S., Bandyopadhyay C., Bottero V., Veettil MV., Wilson L., Pins MR., Johnson KE., Warshall C., Chandran B. "rANG" is of Human origin - see Sadagopan et al., 2009. sujoy.dutta@rosalindfranklin.edu Accepted 2016-SEP-09 AT 16:22 BST AT 16:22 BST by ORCHARD Molecular oncology 2014 Only protein-protein interactions imex curation imex curation Angiogenin interacts with the plasminogen activation system at the cell surface of breast cancer cells to regulate plasmin formation and cell migration. Angiogenin interacts with the plasminogen activation system at the cell surface of breast cancer cells to regulate plasmin formation and cell migration. Molecular oncology 2014 imex curation Dutta S., Bandyopadhyay C., Bottero V., Veettil MV., Wilson L., Pins MR., Johnson KE., Warshall C., Chandran B. "rANG" is of Human origin - see Sadagopan et al., 2009. sujoy.dutta@rosalindfranklin.edu 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-t47d-a18 ER- and PR-positive hormone-responsive clone of t47d t47d-a18 ER- and PR-positive hormone-responsive clone of t47d anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dutta S., Bandyopadhyay C., Bottero V., Veettil MV., Wilson L., Pins MR., Johnson KE., Warshall C., Chandran B. Cell surface biotinylated proteins were isolated and purified by passing cellular lysates through a monomeric avidin column prior to IP. "rANG" is of Human origin - see Sadagopan et al., 2009. sujoy.dutta@rosalindfranklin.edu Accepted 2016-SEP-09 AT 16:22 BST AT 16:22 BST by ORCHARD Molecular oncology 2014 Only protein-protein interactions imex curation imex curation Angiogenin interacts with the plasminogen activation system at the cell surface of breast cancer cells to regulate plasmin formation and cell migration. Angiogenin interacts with the plasminogen activation system at the cell surface of breast cancer cells to regulate plasmin formation and cell migration. Molecular oncology 2014 imex curation Dutta S., Bandyopadhyay C., Bottero V., Veettil MV., Wilson L., Pins MR., Johnson KE., Warshall C., Chandran B. "rANG" is of Human origin - see Sadagopan et al., 2009. sujoy.dutta@rosalindfranklin.edu 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-t47d-a18 ER- and PR-positive hormone-responsive clone of t47d t47d-a18 ER- and PR-positive hormone-responsive clone of t47d anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dutta S., Bandyopadhyay C., Bottero V., Veettil MV., Wilson L., Pins MR., Johnson KE., Warshall C., Chandran B. "rANG" is of Human origin - see Sadagopan et al., 2009. sujoy.dutta@rosalindfranklin.edu Accepted 2016-SEP-09 AT 16:22 BST AT 16:22 BST by ORCHARD Molecular oncology 2014 Only protein-protein interactions imex curation imex curation s10aa_human Protein S100-A10 S100 calcium-binding protein A10 Calpactin-1 light chain Calpactin I light chain p10 protein p11 Cellular ligand of annexin II S100A10 ANX2LG CAL1L CLP11 protein protein human Homo sapiens Human MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK 3E8E03A6E7DD7A8D anxa2_human Annexin A2 ANXA2 ANX2 ANX2L4 CAL1H LPC2D Annexin-2 Annexin II Lipocortin II Calpactin I heavy chain Chromobindin-8 p36 Protein I Placental anticoagulant protein IV Calpactin-1 heavy chain protein protein human Homo sapiens Human MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD 5126E1337A0CBEA1 urok_human Urokinase-type plasminogen activator PLAU protein protein human Homo sapiens Human MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL DIP protein P00749 original sequence version: 130 62C72400BC23115F angi_human Angiogenin Ribonuclease 5 ANG RNASE5 protein protein human Homo sapiens Human MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP 9C462DA3C8D39ACC upar_human Urokinase plasminogen activator surface receptor Monocyte activation antigen Mo3 PLAUR MO3 UPAR protein protein human Homo sapiens Human MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT AB1963EA3DC77171 76876yuoio-1 4 7 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5C ang-anxa2-1 5 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association 6Ai s100a10-ang-1 5 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association 6Aii ang-anxa2-2 5 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association 6Aiii ang-anxa2-3 5 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 6Aiv ang-anxa2-4 2 9 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 6C-4 s100a10-ang-2 2 9 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 6C-2 anxa2-ang-1 2 7 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 6C-3 plaur-ang-1 2 10 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 6C-1 e8ditcg-1 3 9 unspecified role unspecified role ancillary ancillary 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 11A, 13D The addition of recombinant ANG restores the interaction lost in ANG-/- cells. plau-plaur-1 5 9 unspecified role unspecified role ancillary ancillary 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 11B rata5yea4-1 1 6 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization 3B,4B, 4C. ang-s100a10-1 1 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization 4B ang-anxa2-5 1 7 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization 4Bi ang-anxa2-6 1 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization 4Bii ang-anxa2-7 1 10 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization 4C ang-plaur-1 1 10 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization 4Ci ang-plaur-2 1 10 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization 4Cii