IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ An assembly of proteins and lipid domains regulates transport of phosphatidylserine to phosphatidylserine decarboxylase 2 in Saccharomyces cerevisiae. An assembly of proteins and lipid domains regulates transport of phosphatidylserine to phosphatidylserine decarboxylase 2 in Saccharomyces cerevisiae. The Journal of biological chemistry 2014 imex curation Riekhof, Riekhof WR., Wu WI., Jones JL., Nikrad M., Chan MM., Loewen CJ., Voelker DR. voelkerd@njhealth.org 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom anti tag western anti tag western blot anti tag western Riekhof, Riekhof WR., Wu WI., Jones JL., Nikrad M., Chan MM., Loewen CJ., Voelker DR. voelkerd@njhealth.org Accepted 2016-AUG-23 AT 09:20 BST AT 09:20 BST by MGT The Journal of biological chemistry 2014 Only protein-protein interactions imex curation imex curation The duplicate had been headed for the screen (Fig 4A) - obviously I got distracted and never finished it. Now done. 4B was already the directed split Ub for this pair already in this expt. An assembly of proteins and lipid domains regulates transport of phosphatidylserine to phosphatidylserine decarboxylase 2 in Saccharomyces cerevisiae. An assembly of proteins and lipid domains regulates transport of phosphatidylserine to phosphatidylserine decarboxylase 2 in Saccharomyces cerevisiae. The Journal of biological chemistry 2014 imex curation Riekhof, Riekhof WR., Wu WI., Jones JL., Nikrad M., Chan MM., Loewen CJ., Voelker DR. voelkerd@njhealth.org 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined Riekhof, Riekhof WR., Wu WI., Jones JL., Nikrad M., Chan MM., Loewen CJ., Voelker DR. voelkerd@njhealth.org Accepted 2016-AUG-23 AT 09:20 BST AT 09:20 BST by MGT The Journal of biological chemistry 2014 Only protein-protein interactions imex curation imex curation The duplicate had been headed for the screen (Fig 4A) - obviously I got distracted and never finished it. Now done. 4B was already the directed split Ub for this pair already in this expt. An assembly of proteins and lipid domains regulates transport of phosphatidylserine to phosphatidylserine decarboxylase 2 in Saccharomyces cerevisiae. An assembly of proteins and lipid domains regulates transport of phosphatidylserine to phosphatidylserine decarboxylase 2 in Saccharomyces cerevisiae. The Journal of biological chemistry 2014 imex curation Riekhof, Riekhof WR., Wu WI., Jones JL., Nikrad M., Chan MM., Loewen CJ., Voelker DR. voelkerd@njhealth.org 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro liposome binding assay liposome binding assay anti tag western anti tag western blot anti tag western Riekhof, Riekhof WR., Wu WI., Jones JL., Nikrad M., Chan MM., Loewen CJ., Voelker DR. Proteins failed to bind to 100% phosphatidylcholine vesicles, but did to those which contained 10% phosphatidic acid. Binding to phosphatidic acid is therefore inferred. voelkerd@njhealth.org Accepted 2016-AUG-23 AT 09:20 BST AT 09:20 BST by MGT The Journal of biological chemistry 2014 Only protein-protein interactions imex curation imex curation The duplicate had been headed for the screen (Fig 4A) - obviously I got distracted and never finished it. Now done. 4B was already the directed split Ub for this pair already in this expt. An assembly of proteins and lipid domains regulates transport of phosphatidylserine to phosphatidylserine decarboxylase 2 in Saccharomyces cerevisiae. An assembly of proteins and lipid domains regulates transport of phosphatidylserine to phosphatidylserine decarboxylase 2 in Saccharomyces cerevisiae. The Journal of biological chemistry 2014 imex curation Riekhof, Riekhof WR., Wu WI., Jones JL., Nikrad M., Chan MM., Loewen CJ., Voelker DR. voelkerd@njhealth.org 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Riekhof, Riekhof WR., Wu WI., Jones JL., Nikrad M., Chan MM., Loewen CJ., Voelker DR. voelkerd@njhealth.org Accepted 2016-AUG-23 AT 09:20 BST AT 09:20 BST by MGT The Journal of biological chemistry 2014 Only protein-protein interactions imex curation imex curation The duplicate had been headed for the screen (Fig 4A) - obviously I got distracted and never finished it. Now done. 4B was already the directed split Ub for this pair already in this expt. An assembly of proteins and lipid domains regulates transport of phosphatidylserine to phosphatidylserine decarboxylase 2 in Saccharomyces cerevisiae. An assembly of proteins and lipid domains regulates transport of phosphatidylserine to phosphatidylserine decarboxylase 2 in Saccharomyces cerevisiae. The Journal of biological chemistry 2014 imex curation Riekhof, Riekhof WR., Wu WI., Jones JL., Nikrad M., Chan MM., Loewen CJ., Voelker DR. voelkerd@njhealth.org 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Riekhof, Riekhof WR., Wu WI., Jones JL., Nikrad M., Chan MM., Loewen CJ., Voelker DR. voelkerd@njhealth.org Accepted 2016-AUG-23 AT 09:20 BST AT 09:20 BST by MGT The Journal of biological chemistry 2014 Only protein-protein interactions imex curation imex curation The duplicate had been headed for the screen (Fig 4A) - obviously I got distracted and never finished it. Now done. 4B was already the directed split Ub for this pair already in this expt. osh2_yeast Oxysterol-binding protein homolog 2 D2845 YDL019C OSH2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSREDLSIAEDLNQVSKPLLKVKLLEVLGQGDFKHLKALVDNEFQPKDDPSVQQVLNLILHYAVQVAPILLIKEIVAHWVDQVGDEKSSSKSDDGIHLDLNYQDENGNTPLHLAAAQSRSDVISFLLSQKSINDCVKNKAHQQPLDMCKDLNVAQMIQLKRDDYFLETVHSLRAAMNKRDFSKLDSIWKNPRNLNLLDINGIDPETGTTLLYEYSQKKDIEMCQWLLKHGAEATVKDGKGRSPLDLVKNIKLPAKPSNNVTPEIKLKNLLEKNLREQAIVHEDVASSKPPTYKGFLKKWTNFAHGYKLRWFILSGDGNLSYYKDQSHVDRPRGTLKVSTCRLHIDSSEKLNFELLGGITGTTRWRLKGNHPIETTRWVNAIQSAIRFAKDKEILNKKKAVPPSLALKNKSPALISHSKTQGSLPEASQYYQHTLHKEVIQPSSVSLYRRPSNNLSVVSSEIQLNDNLTESGKRFVSKMIENRLDGSKTPVGVHTGSALQRVRSSNTLKSNRSMQSGSGVASPIDKVPNGANLSQSNTTTGSTASLSDNNYIDNFEGDEANSDDEEEDLGINFDRDEEYIKAQYGPYKEKLDMYEQAISIELSSLIELIEQEEPSPEVWLTIKKSLINTSTIFGKLKDLTYKRDKRLVDMVSKQGDVNNVWVQSVKELEMELSNKTERLASIDKERRGLKKILHKKLLESHATAGNKESLENDKEQESDTTASTLGQIAKFISATKEEDEASDADEFYDAAELVDEVTELTEAHPEISTAAAPKHAPPPVPNETDNDSQYVQDEKSKIESNVEKTSQKFEKQNNLVTEDEPKTDQSLKNFKAEDKESQVKEKTKEIASSVIGEKTIVAVTTVQKRKEEYLLKEGSYLGYEDGIRKRLSMDKDDRPKISLWAVLKSMVGKDMTRMTLPVTFNEPTSLLQRVAEDLEYSELLDQAATFEDSTLRTLYVAAFTASSYASTTKRVAKPFNPLLGETFEYSRPDKQYRFFTEQVSHHPPISATWTESPRWDFWGESFVDTKFNGRSFNVKHLGLWHIKLRPNDNEKEELYTWKKPNNTVIGILIGNPQVDNHGEVNVVNHTTGDHCKLYFKARGWRSSGAYEITGEVYNKKKQKVWILGGHWNEAIFAKKVVKDGDLSLEKTRTAASAGNGPTDDGTKFLIWKANDRPEEPFNLTPFAITLNAPQPHLLPWLPPTDTRLRPDQRAMEDGRYDEAGDEKFRVEEKQRAARRKREENNLEYHPQWFVRDTHPITKAKYWRYTGKYWVKRRDHDLKDCGDIF D521957460E7F7C3 D521957460E7F7C3 scs2_yeast Vesicle-associated membrane protein-associated protein SCS2 YER120W SCS2 VAP homolog 1 Choline sensitivity suppressor protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAVEISPDVLVYKSPLTEQSTEYASISNNSDQTIAFKVKTTAPKFYCVRPNAAVVAPGETIQVQVIFLGLTEEPAADFKCRDKFLVITLPSPYDLNGKAVADVWSDLEAEFKQQAISKKIKVKYLISPDVHPAQNQNIQENKETVEPVVQDSEPKEVPAVVNEKEVPAEPETQPPVQVKKEEVPPVVQKTVPHENEKQTSNSTPAPQNQIKEAATVPAENESSSMGIFILVALLILVLGWFYR 45390E24E31D392E 45390E24E31D392E pdr17_yeast Phosphatidylinositol transfer protein PDR17 PDR17 ISS1 PSTB2 SFH4 Phosphatidylserine transport B pathway protein 2 Pleiotropic drug resistance protein 17 SEC14 homolog 3 N0815 YNL264C protein protein yeast Saccharomyces cerevisiae Baker's yeast MGLFSRKRDHTPAVPKEKLIPCDKIFLDPPAKYGNAPLLEPISEDQNEKYRAVLRHFQDDDLKLPENLNDLDNGTHANDRPLSDWEKFWLSRECFLRYLRANKWNTANAIKGLTKTLVWRREIGLTHGKEDKDPLTADKVAVENETGKQVILGFDNAKRPLYYMKNGRQNTESSFRQVQELVYMMETATTVAPQGVEKITVLVDFKSYKEPGIITDKAPPISIARMCLNVMQDHYPERLAKCVLINIPWFAWAFLKMMYPFLDPATKAKAIFDEPFENHIEPSQLDALYNGLLDFKYKHEVYWPDMVKKVDDLRLKRFDRFLKFGGIVGLSEYDTKGQHDELKYPVDMVI C18F0D225A69DB86 osh3_yeast Oxysterol-binding protein homolog 3 YHR073W OSH3 protein protein yeast Saccharomyces cerevisiae Baker's yeast METIDIQNRSFVVRWVKCGRGDVINYQIKPLKKSIEVGIYKKLKSSVDDHASAVHIAPDTKTLLDYTTKSLLHKGSSSNIEEHHRRSSQHSHSSSNGSDNKRKERSYSSLSISGIQQQSQEIPLREKLSASGFTLVKRVGNVSGNTMVQGDLEVKDTDYYYAFILDNSSSKNAKKKILFNASVINGDNQSMISTRSTPPARPTALSRTSTQQDMLFRVGQGRYLQGYLLKKRRKRLQGFKKRFFTLDFRYGTLSYYLNDHNQTCRGEIVISLSSVSANKKDKIIIIDSGMEVWVLKATTKENWQSWVDALQTCFDDQFEDKDTSTLEENPDILDDDKEVINKSSPQDHDHLTPTATTKSALSHRQHTQKDMDDIYVPLPSESYATFSMNLRLIQQRLEQCKKDSLSYKPTTLHQRSEGLNGTHSSSSVFTNNRVSSFNHSSSGMTSSDSLASEEVPSNKTYIEHALYNQLADLEVFVSRFVTQGEVLFKDHQILCKKAKDTRVSLTSYLSENDEFFDAEEEISRGVIILPDTEDDINNIVEETPLLGKSDQNEFTKEVQLSGSEQIASSSVESYTTNDENHSRKHLKNRHKNRRRGHPHHQKTKSAQSSTETFTSKDLFALSYPKSVTRRNDIPEAAASPPSLLSFLRKNVGKDLSSIAMPVTSNEPISILQLISETFEYAPLLTKATQRPDPITFVSAFAISFLSIYRDKTRTLRKPFNPLLAETFELIREDMGFRLISEKVSHRPPVFAFFAEHLDWECSYTVTPSQKFWGKSIELNNEGILRLKFKTTGELFEWTQPTTILKNLIAGERYMEPVNEFEVHSSKGDKSHILFDKAGMFSGRSEGFKVSIIPPPSSNRKKETLAGKWTQSLANETTHETIWEVGDLVSNPKKKYGFTKFTANLNEITEIEKGNLPPTDSRLRPDIRAYEEGNVDKAEEWKLKLEQLQRERRNKGQDVEPKYFEKVSKNEWKYITGPKSYWERRKKHDWSDISQLW B1AD1210EFFB9AFE B1AD1210EFFB9AFE phosphatidic acids phosphatidic acids small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) psd2_yeast Phosphatidylserine decarboxylase proenzyme 2 PSD2 YGR170W protein protein yeast Saccharomyces cerevisiae Baker's yeast MRIIKGRKRGKNKKPTLILKIHVIQAENIEALKTFNCNPVCFVTTNTFYSQKTNKLKNSNTHWNQTLRIKLPRNPTSEWLRIIVYDALPTGAPPTTPSRPRTTTANTSSSTLSNSGLSSHSHSSRNLNVTSKGNQTSTSINSVSSSATPAPSHSSSSLSTTGPGSTHKNRINSYLYLGEAKISLLDLFKRKDTTTSYKFSIEAQRYHLYDMKGGKDQDSLNCNFLVGDILLGFKLECNVKRTPTFQAFNAWRNELNTYLGRIDRNKARMRSSSSLPPPLEDMLSNSSAVSGNEIRREKPYSDTDLAHDEEVNAEDEIDAEESIEDMNSSGSICTERRYDIDNDTIFDSISEVVSLNDEELDILNDFEEADHPNVPDINVHDIDEDTRISLSSMITALDEYDIVEPEDVAKLPAVSENDITSVDDEESENQQESDEEFDIYNEDEREDSDFQSKEYIGSRLLHLQRGKHNKSYANYLYRRAKSNFFISKKEHAMGVVFMHIGAIKNLPALRNRLSKTNYEMDPFIVISFGRRVFKTSWRKHTLNPEFNEYAAFEVFPHETNFAFSIKVVDKDSFSFNDDVAKCELAWFDMLQQQQHENEWIPYEIPLDLTVEPAHAPKQPVLYSSFKYVSYPFLKKSFWKEAVDTSVNLERLDIIQVMLYLERLGSFTMADSFELFQHFNKSAWAGQSITRSQLVEGLQSWRKSTNFKRIWTCPRCMRSCKPTRNARRSKLVLENDLITHFAICTFSKEHKTLKPSYVSSAFASKRWFSKVLIKLTYGKYALGSNNANILVQDRDTGIIIEEKISAHVKLGMRIIYNGKSPESKKFRSLLKTLSIRQGKKFDSTASAKQIEPFIKFHSLDLSQCRDKDFKTFNEFFYRKLKPGSRLPESNNKEILFSPADSRCTVFPTIQESKEIWVKGRKFSIKKLANNYNPETFNDNNCSIGIFRLAPQDYHRFHSPCNGTIGKPVYVDGEYYTVNPMAVRSELDVFGENIRVIIPIDSPQFGKLLYIPIGAMMVGSILLTCKENDVVESGQELGYFKFGGSTIIIIIPHNNFMFDSDLVKNSSERIETLVKVGMSIGHTSNVNELKRIRIKVDDPKKIERIKRTISVSDENAKSTGNVTWEYHTLREMMNKDFAGL 934BA6579E121053 scs22_yeast Vesicle-associated membrane protein-associated protein SCS22 SCS22 VAP homolog 2 YBL091C-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MRIVPEKLVFKAPLNKQSTEYIKLENDGEKRVIFKVRTSAPTKYCVRPNVAIIGAHESVNVQIVFLGLPKSTADDEMDQKRDKFLIVTLPIPAAYQNVEDGELLSDWPNLEEQYKDDIVFKKIKIFHSVLPKRKPSGNHDAESARAPSAGNGQSLSSRALLIITVIALLVGWIYY F738A09B9F94489D osh1_yeast Oxysterol-binding protein homolog 1 SWH1 OSH1 YAR044W YAR042W protein protein yeast Saccharomyces cerevisiae Baker's yeast MEQPDLSSVAISKPLLKLKLLDALRQGSFPNLQDLLKKQFQPLDDPNVQQVLHLMLHYAVQVAPMAVIKEIVHHWVSTTNTTFLNIHLDLNERDSNGNTPLHIAAYQSRGDIVAFLLDQPTINDCVLNNSHLQAIEMCKNLNIAQMMQVKRSTYVAETAQEFRTAFNNRDFGHLESILSSPRNAELLDINGMDPETGDTVLHEFVKKRDVIMCRWLLEHGADPFKRDRKGKLPIELVRKVNENDTATNTKIAIDIELKKLLERATREQSVIDVTNNNLHEAPTYKGYLKKWTNFAQGYKLRWFILSSDGKLSYYIDQADTKNACRGSLNMSSCSLHLDSSEKLKFEIIGGNNGVIRWHLKGNHPIETNRWVWAIQGAIRYAKDREILLHNGPYSPSLALSHGLSSKVSNKENLHATSKRLTKSPHLSKSTLTQNDHDNDDDSTNNNNNKSNNDYDDNNNNNNNDDDDYDDDDESRPLIEPLPLISSRSQSLSEITPGPHSRKSTVSSTRAADIPSDDEGYSEDDSDDDGNSSYTMENGGENDGDEDLNAIYGPYIQKLHMLQRSISIELASLNELLQDKQQHDEYWNTVNTSIETVSEFFDKLNRLTSQREKRMIAQMTKQRDVNNVWIQSVKDLEMELVDKDEKLVALDKERKNLKKMLQKKLNNQPQVETEANEESDDANSMIKGSQESTNTLEEIVKFIEATKESDEDSDADEFFDAEEAASDKKANDSEDLTTNKETPANAKPQEEAPEDESLIVISSPQVEKKNQLLKEGSFVGYEDPVRTKLALDEDNRPKIGLWSVLKSMVGQDLTKLTLPVSFNEPTSLLQRVSEDIEYSHILDQAATFEDSSLRMLYVAAFTASMYASTTNRVSKPFNPLLGETFEYARTDGQYRFFTEQVSHHPPISATWTESPKWDFYGECNVDSSFNGRTFAVQHLGLWYITIRPDHNISVPEETYSWKKPNNTVIGILMGKPQVDNSGDVKVTNHTTGDYCMLHYKAHGWTSAGAYEVRGEVFNKDDKKLWVLGGHWNDSIYGKKVTARGGELTLDRIKTANSATGGPKLDGSKFLIWKANERPSVPFNLTSFALTLNALPPHLIPYLAPTDSRLRPDQRAMENGEYDKAAAEKHRVEVKQRAAKKEREQKGEEYRPKWFVQEEHPVTKSLYWKFNGEYWNKRKNHDFKDCADIF B9DA826745CEB30B yp272_yeast Uncharacterized protein YPL272C YPL272C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELNEISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIYYNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHLGLGGSLGLFFKELRVECPLSLIDDELSANEFLTNSNDNEDNDDEFNERLMEYQFNKVTKHVSGFIMAKLRSWEKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE AFFAA4350583934D psd2-pdr17-2 4 8 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait c region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain c-terminal cub cub c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 2A, 3A, Table 1 pdr17-psd2-3 1 8 unspecified role unspecified role bait bait c-terminal s tag s tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. 2C pdr17-yp272_yeast-1 1 8 unspecified role unspecified role bait bait c-terminal s tag s tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 4C swh1-scs2-1 4 7 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait c-terminal cub cub c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Table 1 yp272_yeast-scs2-1 4 7 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait c-terminal cub cub c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Table 1 Weak interaction osh2-scs2-1 4 7 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait c-terminal cub cub c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Table 1 osh2-scs22-1 4 12 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait c-terminal cub cub c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Table 1 osh3-scs2-1 4 7 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait c-terminal cub cub c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Table 1 osh3-scs22-1 4 12 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait c-terminal cub cub c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Table 1 weak interaction psd2-pdr17-1 4 8 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind range range range range 11 unspecified role unspecified role bait bait c-terminal cub cub c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figs. 5B, Table 1 The coordinates of the N-terminal alpha-helix domain have been estimated based on the start site of the lipid binding domain as given by SUPERFAMILY. yp272_yeast-pdr17-2 4 8 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind range range range range 14 unspecified role unspecified role bait bait c-terminal cub cub c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figs.4B, 5B, Table 1 The coordinates of the N-terminal alpha-helix domain have been estimated based on the start site of the lipid binding domain as given by SUPERFAMILY. phosphatidic acids-yp272_yeast-1 3 8 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 10 unspecified role unspecified role bait bait direct interaction direct interaction Fig. 6 phosphatidic acids-yp272_yeast-2 3 14 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait direct interaction direct interaction Fig. 6 phosphatidic acids-psd2-1 3 11 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait direct interaction direct interaction Fig. 6 64r7u56-1 2 8 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association none pdr17-yp272_yeast-2 5 8 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association 4A