IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Viperin is induced following dengue virus type-2 (DENV-2) infection and has anti-viral actions requiring the C-terminal end of viperin. Viperin is induced following dengue virus type-2 (DENV-2) infection and has anti-viral actions requiring the C-terminal end of viperin. PLoS neglected tropical diseases 2012 imex curation Helbig KJ., Carr JM., Calvert JK., Wati S., Clarke JN., Eyre NS., Narayana SK., Fiches GN., McCartney EM., Beard MR., Helbig KJ., Carr JM., Calvert JK., Wati S., Clarke JN., Eyre NS., Narayana SK., Fiches GN., McCartney EM., Beard MR. Virus - Publications including interactions involving viral proteins DENV-2 NS3-GFP (for which I extensively looked) can be found with ref. to David Jans in more than one strain. Dark ?space = 54? Figure 7B:-Cells were infected with DENV-2 derived from MON601, a laboratory-derived clone; a derivative from the RNA of dengue virus type 2 (DEN-2) New Guinea C strain, constructed and designated pDVWS501 - (GenBank accession no. AF038403).[Ref19] Figure 7C and 8:- The strain of DENV-2 CA-GFP (gift from David Jans);the pEPI–GFP CA construct (PMID: 21148274) is also from the Mon601 strain. However the strain of DENV-2 NS3-GFP (also a gift from David Jans) has not been possible to trace, so a UniProt identifier from the same strain as the other DENV-2 proteins has been used. jill.carr@flinders.edu.au 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Helbig KJ., Carr JM., Calvert JK., Wati S., Clarke JN., Eyre NS., Narayana SK., Fiches GN., McCartney EM., Beard MR., Helbig KJ., Carr JM., Calvert JK., Wati S., Clarke JN., Eyre NS., Narayana SK., Fiches GN., McCartney EM., Beard MR. Virus - Publications including interactions involving viral proteins DENV-2 NS3-GFP (for which I extensively looked) can be found with ref. to David Jans in more than one strain. Figure 7B:-Cells were infected with DENV-2 derived from MON601, a laboratory-derived clone; a derivative from the RNA of dengue virus type 2 (DEN-2) New Guinea C strain, constructed and designated pDVWS501 - (GenBank accession no. AF038403).[Ref19] Figure 7C and 8:- The strain of DENV-2 CA-GFP (gift from David Jans);the pEPI–GFP CA construct (PMID: 21148274) is also from the Mon601 strain. However the strain of DENV-2 NS3-GFP (also a gift from David Jans) has not been possible to trace, so a UniProt identifier from the same strain as the other DENV-2 proteins has been used. jill.carr@flinders.edu.au Accepted 2017-SEP-13 AT 12:00 BST AT 12:00 BST by PPORRAS PLoS neglected tropical diseases 2012 imex curation added-though dubious about this..(no sequence given, or possible to identify) Viperin is induced following dengue virus type-2 (DENV-2) infection and has anti-viral actions requiring the C-terminal end of viperin. Viperin is induced following dengue virus type-2 (DENV-2) infection and has anti-viral actions requiring the C-terminal end of viperin. PLoS neglected tropical diseases 2012 imex curation Helbig KJ., Carr JM., Calvert JK., Wati S., Clarke JN., Eyre NS., Narayana SK., Fiches GN., McCartney EM., Beard MR., Helbig KJ., Carr JM., Calvert JK., Wati S., Clarke JN., Eyre NS., Narayana SK., Fiches GN., McCartney EM., Beard MR. Virus - Publications including interactions involving viral proteins DENV-2 NS3-GFP (for which I extensively looked) can be found with ref. to David Jans in more than one strain. Dark ?space = 54? Figure 7B:-Cells were infected with DENV-2 derived from MON601, a laboratory-derived clone; a derivative from the RNA of dengue virus type 2 (DEN-2) New Guinea C strain, constructed and designated pDVWS501 - (GenBank accession no. AF038403).[Ref19] Figure 7C and 8:- The strain of DENV-2 CA-GFP (gift from David Jans);the pEPI–GFP CA construct (PMID: 21148274) is also from the Mon601 strain. However the strain of DENV-2 NS3-GFP (also a gift from David Jans) has not been possible to trace, so a UniProt identifier from the same strain as the other DENV-2 proteins has been used. jill.carr@flinders.edu.au 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Helbig KJ., Carr JM., Calvert JK., Wati S., Clarke JN., Eyre NS., Narayana SK., Fiches GN., McCartney EM., Beard MR., Helbig KJ., Carr JM., Calvert JK., Wati S., Clarke JN., Eyre NS., Narayana SK., Fiches GN., McCartney EM., Beard MR. Virus - Publications including interactions involving viral proteins DENV-2 NS3-GFP (for which I extensively looked) can be found with ref. to David Jans in more than one strain. Figure 7B:-Cells were infected with DENV-2 derived from MON601, a laboratory-derived clone; a derivative from the RNA of dengue virus type 2 (DEN-2) New Guinea C strain, constructed and designated pDVWS501 - (GenBank accession no. AF038403).[Ref19] Figure 7C and 8:- The strain of DENV-2 CA-GFP (gift from David Jans);the pEPI–GFP CA construct (PMID: 21148274) is also from the Mon601 strain. However the strain of DENV-2 NS3-GFP (also a gift from David Jans) has not been possible to trace, so a UniProt identifier from the same strain as the other DENV-2 proteins has been used. jill.carr@flinders.edu.au Accepted 2017-SEP-13 AT 12:00 BST AT 12:00 BST by PPORRAS PLoS neglected tropical diseases 2012 imex curation added-though dubious about this..(no sequence given, or possible to identify) Viperin is induced following dengue virus type-2 (DENV-2) infection and has anti-viral actions requiring the C-terminal end of viperin. Viperin is induced following dengue virus type-2 (DENV-2) infection and has anti-viral actions requiring the C-terminal end of viperin. PLoS neglected tropical diseases 2012 imex curation Helbig KJ., Carr JM., Calvert JK., Wati S., Clarke JN., Eyre NS., Narayana SK., Fiches GN., McCartney EM., Beard MR., Helbig KJ., Carr JM., Calvert JK., Wati S., Clarke JN., Eyre NS., Narayana SK., Fiches GN., McCartney EM., Beard MR. Virus - Publications including interactions involving viral proteins DENV-2 NS3-GFP (for which I extensively looked) can be found with ref. to David Jans in more than one strain. Dark ?space = 54? Figure 7B:-Cells were infected with DENV-2 derived from MON601, a laboratory-derived clone; a derivative from the RNA of dengue virus type 2 (DEN-2) New Guinea C strain, constructed and designated pDVWS501 - (GenBank accession no. AF038403).[Ref19] Figure 7C and 8:- The strain of DENV-2 CA-GFP (gift from David Jans);the pEPI–GFP CA construct (PMID: 21148274) is also from the Mon601 strain. However the strain of DENV-2 NS3-GFP (also a gift from David Jans) has not been possible to trace, so a UniProt identifier from the same strain as the other DENV-2 proteins has been used. jill.carr@flinders.edu.au 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip rt-pcr reverse transcription pcr RT-PCR Helbig KJ., Carr JM., Calvert JK., Wati S., Clarke JN., Eyre NS., Narayana SK., Fiches GN., McCartney EM., Beard MR., Helbig KJ., Carr JM., Calvert JK., Wati S., Clarke JN., Eyre NS., Narayana SK., Fiches GN., McCartney EM., Beard MR. Virus - Publications including interactions involving viral proteins DENV-2 NS3-GFP (for which I extensively looked) can be found with ref. to David Jans in more than one strain. Figure 7B:-Cells were infected with DENV-2 derived from MON601, a laboratory-derived clone; a derivative from the RNA of dengue virus type 2 (DEN-2) New Guinea C strain, constructed and designated pDVWS501 - (GenBank accession no. AF038403).[Ref19] Figure 7C and 8:- The strain of DENV-2 CA-GFP (gift from David Jans);the pEPI–GFP CA construct (PMID: 21148274) is also from the Mon601 strain. However the strain of DENV-2 NS3-GFP (also a gift from David Jans) has not been possible to trace, so a UniProt identifier from the same strain as the other DENV-2 proteins has been used. jill.carr@flinders.edu.au Accepted 2017-SEP-13 AT 12:00 BST AT 12:00 BST by PPORRAS PLoS neglected tropical diseases 2012 imex curation added-though dubious about this..(no sequence given, or possible to identify) o92835_9flav Core protein Flavivirin protease NS2B regulatory subunit Flavivirin protease NS3 catalytic subunit Genome polyprotein Matrix protein Non-structural protein 1 Non-structural protein 2A Non-structural protein 2B Non-structural protein 3 Non-structural protein 4A Non-structural protein 4B Peptide 2k Peptide pr Protein prM RNA-directed RNA polymerase NS5 Serine protease NS3 Serine protease subunit NS2B Small envelope protein M Envelope protein E Non-structural protein 5 protein protein dengue virus 2 Dengue virus 2 MNNQRKKARNTPFNMLKRERNRVSTVQQLTKRFSLGMLQGRGPLKLFMALVAFLRFLTIPPTAGILKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRRTAGMIIMLIPTVMAFHLTTRNGEPHMIVSRQEKGKSLLFKTEDGVNMCTLMAMDLGELCEDTITYKCPFLRQNEPEDIDCWCNSTSTWVTYGTCTTTGEHRREKRSVALVPHVGMGLETRTETWMSSEGAWKHAQRIETWILRHPGFTIMAAILAYTIGTTHFQRALIFILLTAVAPSMTMRCIGISNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTDSRCPTQGEPSLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIVTCAMFTCKKNMKGKVVQPENLEYTIVITPHSGEEHAVGNDTGKHGKEIKITPQSSITEAELTGYGTVTMECSPRTGLDFNEMVLLQMENKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKKGSSIGQMIETTMRGAKRMAILGDTAWDFGSLGGVFTSIGKALHQVFGAIYGAAFSGVSWTMKILIGVIITWIGMNSRSTSLSVSLVLVGVVTLYLGVMVQADSGCVVSWKNKELKCGSGIFITDNVHTWTEQYKFQPESPSKLASAIQKAHEEGICGIRSVTRLENLMWKQITPELNHILSENEVKLTIMTGDIKGIMQAGKRSLQPQPTELKYSWKTWGKAKMLSTESHNQTFLIDGPETAECPNTNRAWNSLEVEDYGFGVFTTNIWLKLREKQDVFCDSKLMSAAIKDNRAVHADMGYWIESALNDTWKIEKASFIEVKSCHWPKSHTLWSNGVLESEMIIPKNFAGPVSQHNYRPGYHTQTAGPWHLGKLEMDFDFCEGTTVVVTEDCGNRGPSLRTTTASGKLITEWCCRSCTLPPLRYRGEDGCWYGMEIRPLKEKEENLVNSLVTAGHGQIDNFSLGVLGMALFLEEMLRTRVGTKHAILLVAVSFVTLITGNMSFRDLGRVMVMVGATMTDDIGMGVTYLALLAAFKVRPTFAAGLLLRKLTSKELMMTTIGIVLLSQSTIPETILELTDALALGMMVLKMVRKMEKYQLAVTIMAILCVPNAVILQNAWKVSCTILAVVSVSPLFLTSSQQKADWIPLALTIKGLNPTAIFLTTLSRTNKKRSWPLNEAIMAVGMVSILASSLLKNDIPMTGPLVAGGLLTVCYVLTGRSADLELERAADVKWEDQAEISGSSPILSITISEDGSMSIKNEEEEQTLTILIRTGLLVISGLFPVSIPITAAAWYLWEVKKQRAGVLWDVPSPPPVGKAELEDGAYRIKQKGILGYSQIGAGVYKEGTFHTMWHVTRGAVLMHKGKRIEPSWADVKKDLISYGGGWKLEGEWKEGEEVQVLALEPGKNPRAVQTKPGLFKTNAGTIGAVSLDFSPGTSGSPIIDKKGKVVGLYGNGVVTRSGAYVSAIAQTEKSIEDNPEIEDDIFRKRKLTIMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAEMEEALRGLPIRYQTPAIRAEHTGREIVDLMCHATFTMRLLSPVRVPNYNLIIMDEAHFTDPASIAARGYISTRVEMGEAAGIFMTATPPGSRDPFPQSNAPIMDEEREIPERSWSSGHEWVTDFKGKTVWFVPSIKAGNDIAACLRKNGKKVIQLSRKTFDSEYVKTRTNDWDFVVTTDISEMGANFKAERVIDPRRCMKPVILTDGEERVILAGPMPVTHSSAAQRRGRIGRNPKNENDQYIYMGEPLENDEDCAHWKEAKMLLDNINTPEGIIPSMFEPEREKVDAIDGEYRLRGEARKTFVDLMRRGDLPVWLAYRVAAEGINYADRRWCFDGIKNNQILEENVEVEIWTKEGERKKLKPRWLDARIYSDPLTLKEFKEFAAGRKSLTLNLITEMGRLPTFMTQKARDALDNLAVLHTAEAGGRAYNHALSELPETLETLLLLTLLATVTGGIFLFLMSGRGIGKMTLGMCCIITASILLWYAQIQPHWIAASIILEFFLIVLLIPEPEKQRTPQDNQLTYVVIAILTVVAATMANEMGFLEKTKKDLGLGSITTQQPESNILDIDLRPASAWTLYAVATTFVTPMLRHSIENSSVNVSLTAIANQATVLMGLGKGWPLSKMDIGVPLLAIGCYSQVNPITLTAALFLLVAHYAIIGPGLQAKATREAQKRAAAGIMKNPTVDGITVIDLDPIPYDPKFEKQLGQVMLLVLCVTQVLMMRTTWALCEALTLATGPISTLWEGNPGRFWNTTIAVSMANIFRGSYLAGAGLLFSIMKNTTNTRRGTGNIGETLGEKWKSRLNALGKSEFQIYKKSGIQEVDRTLAKEGIKRGETDHHAVSRGSAKLRWFVERNMVTPEGKVVDLGCGRGGWSYYCGGLKNVREVKGLTKGGPGHEEPIPMSTYGWNLVRLQSGVDVFFTPPEKCDTLLCDIGESSPNPTVEAGRTLRVLNLVENWLNNNTQFCIKVLNPYMPSVIEKMEALQRKYGGALVRNPLSRNSTHEMYWVSNASGNIVSSVNMISRMLINRFTMRHKKATYEPDVDLGSGTRNIGIESEIPNLDIIGKRIEKIKQEHETSWHYDQDHPYKTWAYHGSYETKQTGSASSMVNGVVRLLTKPWDVVPMVTQMAMTDTTPFGQQRVFKEKVDTRTQEPKEGTKKLMKITAEWLWKELGKKKTPRMCTREEFTRKVRSNAALGAIFTDENKWKSAREAVEDSRFWELVDKERNLHLEGKCETCVYNMMGKREKKLGEFGKAKGSRAIWYMWLGARFLEFEALGFLNEDHWFSRENSLSGVEGEGLHKLGYILRDVSKKEGGAMYADDTAGWDTRITLEDLKNEEMVTNHMEGEHKKLAEAIFKLTYQNKVVRVQRPTPRGTVMDIISRRDQRGSGQVGTYGLNTFTNMEAQLIRQMEGEGVFKSIQHLTVTEEIAVQNWLARVGRERLSRMAISGDDCVVKPLDDRFASALTALNDMGKVRKDIQQWEPSRGWNDWTQVPFCSHHFHELIMKDGRVLVVPCRNQDELIGRARISQGAGWSLRETACLGKSYAQMWSLMYFHRRDLRLAANAICSAVPSHWVPTSRTTWSIHAKHEWMTTEDMLTVWNRVWIQENPWMEDKTPVESWEEIPYLGKREDQWCGSLIGLTSRATWAKNIQTAINQVRSLIGNEEYTDYMPSMKRFRREEEEAGVLW 380A92B40CE0EFB2 polyprotein mrna mrna messenger rna mRNA mrna den2n Dengue virus type 2 (strain Thailand/NGS-C/1944) (DENV-2) rsad2_human Radical S-adenosyl methionine domain-containing protein 2 RSAD2 CIG5 Cytomegalovirus-induced gene 5 protein Viperin Virus inhibitory protein, endoplasmic reticulum-associated, interferon-inducible protein protein human Homo sapiens Human MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETKEEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW ED014743CE1568DF o92835_9flav-rsad2-1 2 4 unspecified role unspecified role neutral component neutral component Capsid_protein sufficient to bind sufficient binding region sufficient to bind range range range range 6 unspecified role unspecified role neutral component neutral component n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization 7B o92835_9flav-rsad2-2 2 6 unspecified role unspecified role neutral component neutral component n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component NS3_protein sufficient to bind sufficient binding region sufficient to bind range range range range region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 7C N-terminal Viperin deletion mutant loses the ability to colocalise to lipid droplets;the pattern of localisation was solely cytoplasmic. o92835_9flav-rsad2-3 1 4 unspecified role unspecified role fluorescence donor fluorescence donor Capsid_protein sufficient to bind sufficient binding region sufficient to bind range range range range region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept c_terminal_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region mcherry mcherry fluorescent protein tag mcherry undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction 8A o92835_9flav-rsad2-4 1 4 unspecified role unspecified role fluorescence donor fluorescence donor NS3_protein sufficient to bind sufficient binding region sufficient to bind range range range range region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region mcherry mcherry fluorescent protein tag mcherry undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction 8 B/C/D wrer\gs-1 3 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 6C