UniProt UniProt http://www.uniprot.org Mutations affecting the cytoplasmic functions of the co-chaperone DNAJB6 cause limb-girdle muscular dystrophy. Mutations affecting the cytoplasmic functions of the co-chaperone DNAJB6 cause limb-girdle muscular dystrophy. Nature genetics 2012 imex curation Sarparanta J., Jonson PH., Golzio C., Sandell S., Luque H., Screen M., McDonald K., Stajich JM., Mahjneh I., Vihola A., Raheem O., Penttilä S., Lehtinen S., Huovinen S., Palmio J., Tasca G., Ricci E., Hackman P., Hauser M., Katsanis N., Udd B., Sarparanta J., Jonson PH., Golzio C., Sandell S., Luque H., Screen M., McDonald K., Stajich JM., Mahjneh I., Vihola A., Raheem O., Penttilä S., Lehtinen S., Huovinen S., Palmio J., Tasca G., Ricci E., Hackman P., Hauser M., Katsanis N., Udd B. bjarne.udd@netikka.fi 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Sarparanta J., Jonson PH., Golzio C., Sandell S., Luque H., Screen M., McDonald K., Stajich JM., Mahjneh I., Vihola A., Raheem O., Penttilä S., Lehtinen S., Huovinen S., Palmio J., Tasca G., Ricci E., Hackman P., Hauser M., Katsanis N., Udd B. IP with anti-V5 antibodies after dithiobis(succinimidyl propionate) exposure as cross-linker. bjarne.udd@netikka.fi Accepted 2016-NOV-15 AT 15:10 GMT AT 15:10 GMT by MGT Nature genetics 2012 imex curation Mutations affecting the cytoplasmic functions of the co-chaperone DNAJB6 cause limb-girdle muscular dystrophy. Mutations affecting the cytoplasmic functions of the co-chaperone DNAJB6 cause limb-girdle muscular dystrophy. Nature genetics 2012 imex curation Sarparanta J., Jonson PH., Golzio C., Sandell S., Luque H., Screen M., McDonald K., Stajich JM., Mahjneh I., Vihola A., Raheem O., Penttilä S., Lehtinen S., Huovinen S., Palmio J., Tasca G., Ricci E., Hackman P., Hauser M., Katsanis N., Udd B., Sarparanta J., Jonson PH., Golzio C., Sandell S., Luque H., Screen M., McDonald K., Stajich JM., Mahjneh I., Vihola A., Raheem O., Penttilä S., Lehtinen S., Huovinen S., Palmio J., Tasca G., Ricci E., Hackman P., Hauser M., Katsanis N., Udd B. bjarne.udd@netikka.fi 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions rat-skeletal_muscle rat skeletal muscle skeletal_muscle Skeletal muscle pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Sarparanta J., Jonson PH., Golzio C., Sandell S., Luque H., Screen M., McDonald K., Stajich JM., Mahjneh I., Vihola A., Raheem O., Penttilä S., Lehtinen S., Huovinen S., Palmio J., Tasca G., Ricci E., Hackman P., Hauser M., Katsanis N., Udd B. rat gastrocnemius muscle bjarne.udd@netikka.fi Accepted 2016-NOV-15 AT 15:10 GMT AT 15:10 GMT by MGT Nature genetics 2012 imex curation Mutations affecting the cytoplasmic functions of the co-chaperone DNAJB6 cause limb-girdle muscular dystrophy. Mutations affecting the cytoplasmic functions of the co-chaperone DNAJB6 cause limb-girdle muscular dystrophy. Nature genetics 2012 imex curation Sarparanta J., Jonson PH., Golzio C., Sandell S., Luque H., Screen M., McDonald K., Stajich JM., Mahjneh I., Vihola A., Raheem O., Penttilä S., Lehtinen S., Huovinen S., Palmio J., Tasca G., Ricci E., Hackman P., Hauser M., Katsanis N., Udd B., Sarparanta J., Jonson PH., Golzio C., Sandell S., Luque H., Screen M., McDonald K., Stajich JM., Mahjneh I., Vihola A., Raheem O., Penttilä S., Lehtinen S., Huovinen S., Palmio J., Tasca G., Ricci E., Hackman P., Hauser M., Katsanis N., Udd B. bjarne.udd@netikka.fi 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sarparanta J., Jonson PH., Golzio C., Sandell S., Luque H., Screen M., McDonald K., Stajich JM., Mahjneh I., Vihola A., Raheem O., Penttilä S., Lehtinen S., Huovinen S., Palmio J., Tasca G., Ricci E., Hackman P., Hauser M., Katsanis N., Udd B. Origin of overexpressed myc-STUB1 according Ref. 56 (PMID 16554822; sequence coordinates therein) bjarne.udd@netikka.fi Accepted 2016-NOV-15 AT 15:10 GMT AT 15:10 GMT by MGT Nature genetics 2012 imex curation bag3_cerae_protein African monkey BAG3 protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey hsp7c_rat Heat shock cognate 71 kDa protein Hspa8 Hsc70 Heat shock 70 kDa protein 8 Hsc73 protein protein rat Rattus norvegicus (Rat) Rat MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD DIP protein P63018 original sequence version: 98 03A27B30E6C076ED chip_human E3 ubiquitin-protein ligase CHIP CHIP STUB1 PP1131 Carboxy terminus of Hsp70-interacting protein STIP1 homology and U box-containing protein 1 CLL-associated antigen KW-8 Antigen NY-CO-7 RING-type E3 ubiquitin transferase CHIP protein protein human Homo sapiens Human MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY 7E7D6568B17070BF d4a4t0_rat Stub1 rCG_34526 protein protein rat Rattus norvegicus (Rat) Rat MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLTRLIAAERERELEECQRNHEGDEDDGHIRAQQACIEAKHDKYMADMNELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY mint E6BDCB223FAE1E6F o75190-2 DnaJ homolog subfamily B member 6 HHDJ1 Heat shock protein J2 MSJ-1 DNAJB6 HSJ2 MRJ MSJ1 protein protein human Homo sapiens Human MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFEDFFGNRRGPRGSRSRGTGSFFSAFSGFPSFGSGFSSFDTGFTSFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKMVNGRKITTKRIVENGQERVEVEEDGQLKSLTINGKEQLLRLDNK CD5A49CAB66C2E16 dnjb6_rat DnaJ homolog subfamily B member 6 Dnajb6 Heat shock protein J2 Hsp40 homolog MRJ MSJ-1 protein protein rat Rattus norvegicus (Rat) Rat MVDYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFDDFFGNRRGPRGSRSRGAGSFFSAFSGFPSFGSGFPAFDTGFTPFGSLGHGGLTSFSSASFGGSGMGNFKSISTSTKIVNGKKITTKRIVENGQERVEVEEDGQLKSLTINGVADENALAEECRRRGQPTPALAPGPAPAPARVPSQARPPTPAPTPAPAQTPAPSVSTRPQKPPRPAPTAKLVSKSNWEDEEQDRQRVPGNCDAPMTSAGLKEGGKRKKQKQKEDSKKKKSTKGNH 55899E4DE4DF9E76 dnajb6_cerae_protein African monkey DNAJB6 protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey hspb8_cerae_protein African monkey HSPB8 protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey hspb8_rat Heat shock protein beta-8 Hspb8 Cryac Hsp22 Alpha-crystallin C chain Small stress protein-like protein HSP22 protein protein rat Rattus norvegicus (Rat) Rat MADGQLPFPCSYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTAPWPEWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRNPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSPFGESSFNNELPQDNQEVTCS 7DF3288BB9846635 q5u2u8_rat Bag3 rCG_40209 protein protein rat Rattus norvegicus (Rat) Rat MSAATQSPVMQMASGNGASDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPPEGPKETASSANGPSRDGSRLLPAREGHPIYPQLRPGYIPIPVHHEGSENRQPHLFHAYSQPGVQRFRTEAAAAAPQRSQSPLRGGVTETTQTDKQCGQVPAAATAQPPTAHGPERSQSPAASDCSSSSSSASLPSSGRSSLGSHQLPRGYIPIPVIHEQNITRPAAQPSFHQAQKTHYPAQQGEYQPQQPVYHKIQGDDWEPRPLRATSPFRSPVRGASSREGSPARSGTPVHCPSPIRVHTVVDRPQPMTHREPPPVTQPENKPESKPGLAGPDLPPGHIPIQVIRREADSKPVSQKPPPPAEKVEVKVSSAPIPCPSPGPAPSAVPSSPKNVAAEPKAAPSPAPAEAASLKSGDAEAPHKHPGVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEPEQPLQEIMGAVAADKDKKGPENEDPQTESQQLEAKAATPPNPSSTADSAGNPVAP 49C3858E5BA0F1C8 bag3_human BAG family molecular chaperone regulator 3 Bcl-2-associated athanogene 3 Bcl-2-binding protein Bis Docking protein CAIR-1 BAG3 BIS protein protein human Homo sapiens Human MSAATHSPMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPKETPSSANGPSREGSRLPPAREGHPVYPQLRPGYIPIPVLHEGAENRQVHPFHVYPQPGMQRFRTEAAAAAPQRSQSPLRGMPETTQPDKQCGQVAAAAAAQPPASHGPERSQSPAASDCSSSSSSASLPSSGRSSLGSHQLPRGYISIPVIHEQNVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAASPFRSSVQGASSREGSPARSSTPLHSPSPIRVHTVVDRPQQPMTHRETAPVSQPENKPESKPGPVGPELPPGHIPIQVIRKEVDSKPVSQKPPPPSEKVEVKVPPAPVPCPPPSPGPSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHPGVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP DIP protein O95817 original sequence version: 108 A6328A44F37A406A dnajb6-bag3-1 3 4 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range O75190-2:p.Phe93Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain F L Wed May 02 16:51:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe93leu' Tue Jun 30 19:27:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe93Leu' Mutation phe93leu (assoiated with Limb-girdle muscular dystrophy 1E (LGMD1E) [MIM:603511] ) does not change the association 6 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association Supplementary 9b dnajb6-hspb8-1 2 12 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 5B bag3-dnajb6-1 2 13 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 5B dnajb6-stub1-1 2 7 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 5B dnajb6-hspa8-1 2 5 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 5B dnajb6-bag3_cerae_protein-1 3 4 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range O75190-2:p.Phe93Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain F L Wed May 02 19:52:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe93leu' Tue Jun 30 16:52:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe93Leu' physical association physical association Supplementary 9a dnajb6-dnajb6-1 3 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supplementary 6a dnajb6-dnajb6-2 3 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range O75190-2:p.Phe93Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain F L Wed May 02 15:20:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe93leu' Tue Jun 30 18:10:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe93Leu' 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection O75190-2:p.Phe93Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain F L Wed May 02 18:07:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe93leu' Tue Jun 30 19:51:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe93Leu' physical association physical association Supplementary 6a dnajb6-bag3_cerae_protein-2 1 11 unspecified role unspecified role neutral component neutral component chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 4 unspecified role unspecified role neutral component neutral component chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 10 unspecified role unspecified role neutral component neutral component chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 8 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range O75190-2:p.Phe93Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain F L Wed May 02 15:28:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe93leu' Tue Jun 30 17:23:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe93Leu' chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 association association 5a