IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The plasma membrane-associated GTPase Rin interacts with the dopamine transporter and is required for protein kinase C-regulated dopamine transporter trafficking. The plasma membrane-associated GTPase Rin interacts with the dopamine transporter and is required for protein kinase C-regulated dopamine transporter trafficking. The Journal of neuroscience : the official journal of the Society for Neuroscience 2011 imex curation Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE. Transfected DAT is of Human origin: see references in Methods;Cell culture and transfections haley.melikian@umassmed.edu 8-Jun-2017: Contacted by IntAct-Help. via Pablo- see email received on 22/3/16 with useful (?) further details Only protein-protein interactions imex curation rat-brain-striatum Rattus norvegicus brian stiatum brain_striatum Brain striatum, Neostratum. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE. striatal synaptosomes Transfected DAT is of Human origin: see references in Methods;Cell culture and transfections haley.melikian@umassmed.edu Accepted 2017-APR-18 AT 11:15 BST AT 11:15 BST by PPORRAS via Pablo- see email received on 22/3/16 with useful (?) further details The Journal of neuroscience : the official journal of the Society for Neuroscience 2011 Only protein-protein interactions imex curation imex curation The plasma membrane-associated GTPase Rin interacts with the dopamine transporter and is required for protein kinase C-regulated dopamine transporter trafficking. The plasma membrane-associated GTPase Rin interacts with the dopamine transporter and is required for protein kinase C-regulated dopamine transporter trafficking. The Journal of neuroscience : the official journal of the Society for Neuroscience 2011 imex curation Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE. Transfected DAT is of Human origin: see references in Methods;Cell culture and transfections haley.melikian@umassmed.edu 8-Jun-2017: Contacted by IntAct-Help. via Pablo- see email received on 22/3/16 with useful (?) further details Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE. Transfected DAT is of Human origin: see references in Methods;Cell culture and transfections haley.melikian@umassmed.edu Accepted 2017-APR-18 AT 11:15 BST AT 11:15 BST by PPORRAS via Pablo- see email received on 22/3/16 with useful (?) further details The Journal of neuroscience : the official journal of the Society for Neuroscience 2011 Only protein-protein interactions imex curation imex curation The plasma membrane-associated GTPase Rin interacts with the dopamine transporter and is required for protein kinase C-regulated dopamine transporter trafficking. The plasma membrane-associated GTPase Rin interacts with the dopamine transporter and is required for protein kinase C-regulated dopamine transporter trafficking. The Journal of neuroscience : the official journal of the Society for Neuroscience 2011 imex curation Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE. Transfected DAT is of Human origin: see references in Methods;Cell culture and transfections haley.melikian@umassmed.edu 8-Jun-2017: Contacted by IntAct-Help. via Pablo- see email received on 22/3/16 with useful (?) further details Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE. Positive control interactions have not been annotated as the origins and identity of the Transferrin molecule are not stated. I have entered positive results from Fig 3B only. Transfected DAT is of Human origin: see references in Methods;Cell culture and transfections haley.melikian@umassmed.edu Accepted 2017-APR-18 AT 11:15 BST AT 11:15 BST by PPORRAS via Pablo- see email received on 22/3/16 with useful (?) further details The Journal of neuroscience : the official journal of the Society for Neuroscience 2011 Only protein-protein interactions imex curation imex curation The plasma membrane-associated GTPase Rin interacts with the dopamine transporter and is required for protein kinase C-regulated dopamine transporter trafficking. The plasma membrane-associated GTPase Rin interacts with the dopamine transporter and is required for protein kinase C-regulated dopamine transporter trafficking. The Journal of neuroscience : the official journal of the Society for Neuroscience 2011 imex curation Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE. Transfected DAT is of Human origin: see references in Methods;Cell culture and transfections haley.melikian@umassmed.edu 8-Jun-2017: Contacted by IntAct-Help. via Pablo- see email received on 22/3/16 with useful (?) further details Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE. Myr: cannot enter as MOD_RES (Myrres) as it is not directly linked to the Prey. A version of Y2H assay used for proteins that are transcriptional activators or repressors, require post-translational modification in the cytoplasm, or are toxic to yeast. Library cDNAs are myristylated (myr) and thereby anchored at the plasma membrane. Baits are cloned in-frame with the Ras guanine nucleotide exchange factor, hSOS Thus, interactions between bait and library prey occur at or near the plasma membrane. Screens take place in the temperature-sensitive mutant yeast strain cdc25H, which lacks Ras signaling and is unable to grow at the restrictive temperature. Protein–protein interactions localize hSOS to the plasma membrane, activate Ras signaling, and rescue the temperature-sensitive phenotype. Transfected DAT is of Human origin: see references in Methods;Cell culture and transfections haley.melikian@umassmed.edu Accepted 2017-APR-18 AT 11:15 BST AT 11:15 BST by PPORRAS via Pablo- see email received on 22/3/16 with useful (?) further details The Journal of neuroscience : the official journal of the Society for Neuroscience 2011 Only protein-protein interactions imex curation imex curation The plasma membrane-associated GTPase Rin interacts with the dopamine transporter and is required for protein kinase C-regulated dopamine transporter trafficking. The plasma membrane-associated GTPase Rin interacts with the dopamine transporter and is required for protein kinase C-regulated dopamine transporter trafficking. The Journal of neuroscience : the official journal of the Society for Neuroscience 2011 imex curation Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE. Transfected DAT is of Human origin: see references in Methods;Cell culture and transfections haley.melikian@umassmed.edu 8-Jun-2017: Contacted by IntAct-Help. via Pablo- see email received on 22/3/16 with useful (?) further details Only protein-protein interactions imex curation rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE. Transfected DAT is of Human origin: see references in Methods;Cell culture and transfections haley.melikian@umassmed.edu Accepted 2017-APR-18 AT 11:15 BST AT 11:15 BST by PPORRAS via Pablo- see email received on 22/3/16 with useful (?) further details The Journal of neuroscience : the official journal of the Society for Neuroscience 2011 Only protein-protein interactions imex curation imex curation The plasma membrane-associated GTPase Rin interacts with the dopamine transporter and is required for protein kinase C-regulated dopamine transporter trafficking. The plasma membrane-associated GTPase Rin interacts with the dopamine transporter and is required for protein kinase C-regulated dopamine transporter trafficking. The Journal of neuroscience : the official journal of the Society for Neuroscience 2011 imex curation Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE. Transfected DAT is of Human origin: see references in Methods;Cell culture and transfections haley.melikian@umassmed.edu 8-Jun-2017: Contacted by IntAct-Help. via Pablo- see email received on 22/3/16 with useful (?) further details Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE. Myr: cannot enter as MOD_RES (Myrres) as it is not directly linked to the Prey. A version of Y2H assay used for proteins that are transcriptional activators or repressors, require post-translational modification in the cytoplasm, or are toxic to yeast. Library cDNAs are myristylated (myr) and thereby anchored at the plasma membrane. Baits are cloned in-frame with the Ras guanine nucleotide exchange factor, hSOS Thus, interactions between bait and library prey occur at or near the plasma membrane. Screens take place in the temperature-sensitive mutant yeast strain cdc25H, which lacks Ras signaling and is unable to grow at the restrictive temperature. Protein–protein interactions localize hSOS to the plasma membrane, activate Ras signaling, and rescue the temperature-sensitive phenotype. Transfected DAT is of Human origin: see references in Methods;Cell culture and transfections haley.melikian@umassmed.edu Accepted 2017-APR-18 AT 11:15 BST AT 11:15 BST by PPORRAS via Pablo- see email received on 22/3/16 with useful (?) further details human substantia nigra cDNA library. The Journal of neuroscience : the official journal of the Society for Neuroscience 2011 Only protein-protein interactions imex curation imex curation The plasma membrane-associated GTPase Rin interacts with the dopamine transporter and is required for protein kinase C-regulated dopamine transporter trafficking. The plasma membrane-associated GTPase Rin interacts with the dopamine transporter and is required for protein kinase C-regulated dopamine transporter trafficking. The Journal of neuroscience : the official journal of the Society for Neuroscience 2011 imex curation Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE. Transfected DAT is of Human origin: see references in Methods;Cell culture and transfections haley.melikian@umassmed.edu 8-Jun-2017: Contacted by IntAct-Help. via Pablo- see email received on 22/3/16 with useful (?) further details Only protein-protein interactions imex curation rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE., Navaroli DM., Stevens ZH., Uzelac Z., Gabriel L., King MJ., Lifshitz LM., Sitte HH., Melikian HE. Transfected DAT is of Human origin: see references in Methods;Cell culture and transfections haley.melikian@umassmed.edu Accepted 2017-APR-18 AT 11:15 BST AT 11:15 BST by PPORRAS via Pablo- see email received on 22/3/16 with useful (?) further details The Journal of neuroscience : the official journal of the Society for Neuroscience 2011 Only protein-protein interactions imex curation imex curation rit2_human GTP-binding protein Rit2 RIT2 ROC2 RIN Ras-like protein expressed in neurons Ras-like without CAAX protein 2 protein protein human Homo sapiens Human MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDSLWKKLKGSLKKKRENMT CD2A9ECE4AEAA792 sc6a3_human Sodium-dependent dopamine transporter SLC6A3 DAT1 Solute carrier family 6 member 3 protein protein human Homo sapiens Human MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQLTACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSVDFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSSGFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGIDSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAAGTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKDRELVDRGEVRQFTLRHWLKV DIP protein Q01959 original sequence version: 150 DIP protein Q01959 original sequence version: 119 CD95009B6BA93108 sc6a3_rat Sodium-dependent dopamine transporter Slc6a3 Solute carrier family 6 member 3 protein protein rat Rattus norvegicus (Rat) Rat MSKSKCSVGPMSSVVAPAKESNAVGPREVELILVKEQNGVQLTNSTLINPPQTPVEAQERETWSKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAWALHYFFSSFTMDLPWIHCNNTWNSPNCSDAHASNSSDGLGLNDTFGTTPAAEYFERGVLHLHQSRGIDDLGPPRWQLTACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAMDGIRAYLSVDFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTSINSLTSFSSGFVVFSFLGYMAQKHNVPIRDVATDGPGLIFIIYPEAIATLPLSSAWAAVFFLMLLTLGIDSAMGGMESVITGLVDEFQLLHRHRELFTLGIVLATFLLSLFCVTNGGIYVFTLLDHFAAGTSILFGVLIEAIGVAWFYGVQQFSDDIKQMTGQRPNLYWRLCWKLVSPCFLLYVVVVSIVTFRPPHYGAYIFPDWANALGWIIATSSMAMVPIYATYKFCSLPGSFREKLAYAITPEKDHQLVDRGEVRQFTLRHWLLL Amine transporter. Terminates the action of dopamine by its high affinity sodium-dependent reuptake into presynaptic terminals mint DF3A30C981095D24 rit2_rat GTP-binding protein Rit2 Rit2 protein protein rat Rattus norvegicus (Rat) Rat MEAENEAHCCPGSSSGGSREYKVVMLGAGGVGKSAVTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGMTLARDYNCAFFETSAALRFGIDDAFQGLVREIRRKESMLSLVERKLKRKDSLWKKIKASLKKKRENMI 4D12C7B0D3F46903 slc6a3-rit2-1 6 8 unspecified role unspecified role prey prey myr fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human_sos (aas 1-1067) fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association none slc6a3-rit2-2 7 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait Q01959:p.Phe587_Lys590delinsAlaAlaAlaAla mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain FREK AAAA Fri Jul 22 11:14:43 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'phe587ala,arg588ala,glu589ala,lys590ala' Wed May 02 16:33:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe_arg_glu_lys587-590ala_ala_ala_ala' Tue Jun 30 17:07:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe587_Lys590delinsAlaAlaAlaAla' physical association physical association 1B, 5A-C PMA (Phorbol myristate acetate) - a mitogen, but only for WT DAT. This action of PMA is blocked by BIM. slc6a3-rit2-3 1 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 1C slc6a3-rit2-4 5 8 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component colocalization colocalization 2A-C, 7 PMA treatment resulted in marked DAT redistribution to intracellular puncta, however both RinQ78L and S34N mutants failed to dissociate from DAT under these conditions. rit2-slc6a3-1 3 8 unspecified role unspecified role fluorescence donor fluorescence donor region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction 3-1 rit2-slc6a3-2 3 9 unspecified role unspecified role fluorescence donor fluorescence donor region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction 3-2 slc6a3-rit2-5 3 9 unspecified role unspecified role fluorescence donor fluorescence donor region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction 3-3 slc6a3-rit2-6 2 11 unspecified role unspecified role prey prey cell lysate cell lysate rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells 9 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q01959:p.Phe587_Lys590delinsAlaAlaAlaAla mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain FREK AAAA Thu Dec 08 14:36:19 GMT 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'phe587ala,arg588ala,glu589ala,lys590ala' Wed May 02 20:15:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe_arg_glu_lys587-590ala_ala_ala_ala' Tue Jun 30 17:19:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe587_Lys590delinsAlaAlaAlaAla' ecoli Escherichia coli (strain K12) physical association physical association 4, 5D slc6a3-rit2-7 4 8 unspecified role unspecified role prey prey myr fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait human_sos (aas 1-1067) fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association none