UniProt UniProt http://www.uniprot.org Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells. Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells. Molecular biology of the cell 2011 imex curation Kang J., Chaudhary J., Dong H., Kim S., Brautigam CA., Yu H. hongtao.yu@utsouthwestern.edu 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kang J., Chaudhary J., Dong H., Kim S., Brautigam CA., Yu H. hongtao.yu@utsouthwestern.edu hongtao@yu@utsouthwestern.edu Accepted 2016-DEC-08 AT 11:06 GMT AT 11:06 GMT by MGT Molecular biology of the cell 2011 imex curation Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells. Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells. Molecular biology of the cell 2011 imex curation Kang J., Chaudhary J., Dong H., Kim S., Brautigam CA., Yu H. hongtao.yu@utsouthwestern.edu 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Kang J., Chaudhary J., Dong H., Kim S., Brautigam CA., Yu H. The sequence of the Sgo1P1 peptide has been deduced from the text:-"The N-terminal segment of Sgo1P1 (residues 448–452) forms antiparallel beta sheet interactions with beta4 of one CSD monomer, whereas the C-terminal segment of Sgo1P1 (residues 453–456)...". The ITC methods states "The Sgo1P1 (residues 425–443)..." is clearly not correct as it does not agree with sequence numbering given in Fig 4A. hongtao.yu@utsouthwestern.edu hongtao@yu@utsouthwestern.edu Accepted 2016-DEC-08 AT 11:06 GMT AT 11:06 GMT by MGT Molecular biology of the cell 2011 imex curation Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells. Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells. Molecular biology of the cell 2011 imex curation Kang J., Chaudhary J., Dong H., Kim S., Brautigam CA., Yu H. hongtao.yu@utsouthwestern.edu 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Kang J., Chaudhary J., Dong H., Kim S., Brautigam CA., Yu H. hongtao.yu@utsouthwestern.edu hongtao@yu@utsouthwestern.edu Accepted 2016-DEC-08 AT 11:06 GMT AT 11:06 GMT by MGT Molecular biology of the cell 2011 imex curation Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells. Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells. Molecular biology of the cell 2011 imex curation Kang J., Chaudhary J., Dong H., Kim S., Brautigam CA., Yu H. hongtao.yu@utsouthwestern.edu 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kang J., Chaudhary J., Dong H., Kim S., Brautigam CA., Yu H. hongtao.yu@utsouthwestern.edu hongtao@yu@utsouthwestern.edu Accepted 2016-DEC-08 AT 11:06 GMT AT 11:06 GMT by MGT Molecular biology of the cell 2011 imex curation Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells. Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells. Molecular biology of the cell 2011 imex curation Kang J., Chaudhary J., Dong H., Kim S., Brautigam CA., Yu H. hongtao.yu@utsouthwestern.edu 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kang J., Chaudhary J., Dong H., Kim S., Brautigam CA., Yu H. hongtao.yu@utsouthwestern.edu hongtao@yu@utsouthwestern.edu Accepted 2016-DEC-08 AT 11:06 GMT AT 11:06 GMT by MGT Molecular biology of the cell 2011 imex curation Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells. Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells. Molecular biology of the cell 2011 imex curation Kang J., Chaudhary J., Dong H., Kim S., Brautigam CA., Yu H. hongtao.yu@utsouthwestern.edu 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kang J., Chaudhary J., Dong H., Kim S., Brautigam CA., Yu H. hongtao.yu@utsouthwestern.edu hongtao@yu@utsouthwestern.edu Accepted 2016-DEC-08 AT 11:06 GMT AT 11:06 GMT by MGT Molecular biology of the cell 2011 imex curation sgo1_human Shugoshin 1 SGO1 SGOL1 Serologically defined breast cancer antigen NY-BR-85 Shugoshin-like 1 protein protein human Homo sapiens Human MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSGEAKSTDNVLPRTVSVRSSLKKHCNSICQFDSLDDFETSHLAGKSFEFERVGFLDPLVNMHIPENVQHNACQWSKDQVNLSPKLIQPGTFTKTKEDILESKSEQTKSKQRDTQERKREEKRKANRRKSKRMSKYKENKSENKKTVPQKKMHKSVSSNDAYNFNLEEGVHLTPFRQKVSNDSNREENNESEVSLCESSGSGDDSDDLYLPTCKYIQNPTSNSDRPVTRPLAKRALKYTDEKETEGSKPTKTPTTTPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR DIP protein Q5FBB7 original sequence version: 89 DIP protein Q5FBB7 original sequence version: 64 DIP protein Q5FBB7 original sequence version: 92 DIP protein Q5FBB7 original sequence version: 98 90CEE0FD2B40CD9C cbx3_human Chromobox protein homolog 3 CBX3 Heterochromatin protein 1 homolog gamma Modifier 2 protein HECH protein protein human Homo sapiens Human MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ DIP protein Q13185 original sequence version: 147 DIP protein Q13185 original sequence version: 134 DIP protein Q13185 original sequence version: 145 5928C63E0C93A76A ince_human Inner centromere protein INCENP protein protein human Homo sapiens Human MGTTAPGPIHLLELCDQKLMEFLCNMDNKDLVWLEEIQEEAERMFTREFSKEPELMPKTPSQKNRRKKRRISYVQDENRDPIRRRLSRRKSRSSQLSSRRLRSKDSVEKLATVVGENGSVLRRVTRAAAAAAAATMALAAPSSPTPESPTMLTKKPEDNHTQCQLVPVVEIGISERQNAEQHVTQLMSTEPLPRTLSPTPASATAPTSQGIPTSDEESTPKKSKARILESITVSSLMATPQDPKGQGVGTGRSASKLRIAQVSPGPRDSPAFPDSPWRERVLAPILPDNFSTPTGSRTDSQSVRHSPIAPSSPSPQVLAQKYSLVAKQESVVRRASRRLAKKTAEEPAASGRIICHSYLERLLNVEVPQKVGSEQKEPPEEAEPVAAAEPEVPENNGNNSWPHNDTEIANSTPNPKPAASSPETPSAGQQEAKTDQADGPREPPQSARRKRSYKQAVSELDEEQHLEDEELQPPRSKTPSSPCPASKVVRPLRTFLHTVQRNQMLMTPTSAPRSVMKSFIKRNTPLRMDPKCSFVEKERQRLENLRRKEEAEQLRRQKVEEDKRRRLEEVKLKREERLRKVLQARERVEQMKEEKKKQIEQKFAQIDEKTEKAKEERLAEEKAKKKAAAKKMEEVEARRKQEEEARRLRWLQQEEEERRHQELLQKKKEEEQERLRKAAEAKRLAEQREQERREQERREQERREQERREQERREQERQLAEQERRREQERLQAERELQEREKALRLQKEQLQRELEEKKKKEEQQRLAERQLQEEQEKKAKEAAGASKALNVTVDVQSPACTSYQMTPQGHRAPPKINPDNYGMDLNSDDSTDDEAHPRKPIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKRTSSAVWNSPPLQGARVPSSLAYSLKKH DIP protein Q9NQS7 original sequence version: 83 DIP protein Q9NQS7 original sequence version: 86 644D081DCC9035E8 aurkb_human Aurora kinase B AIRK2 Aurora- and IPL1-like midbody-associated protein 1 Aurora/IPL1-related kinase 2 STK-1 Serine/threonine-protein kinase 12 Serine/threonine-protein kinase 5 STK1 STK5 Aurora 1 AURKB AIK2 AIM1 ARK2 STK12 Serine/threonine-protein kinase aurora-B protein protein human Homo sapiens Human MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEHQLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATIMEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYLPPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGAQDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA DIP protein Q96GD4 original sequence version: 88 DIP protein Q96GD4 original sequence version: 113 DIP protein Q96GD4 original sequence version: 116 DIP protein Q96GD4 original sequence version: 122 DIP protein Q96GD4 original sequence version: 177 DIP protein Q96GD4-1 original sequence version: 177 A5ED13EF5A1FAFBF cbx5_human Chromobox protein homolog 5 CBX5 Heterochromatin protein 1 homolog alpha Antigen p25 HP1A protein protein human Homo sapiens Human MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS DIP protein P45973 original sequence version: 138 DIP protein P45973 original sequence version: 116 DIP protein P45973 original sequence version: 115 DIP protein P45973 original sequence version: 124 DIP protein P45973 original sequence version: 154 DIP protein P45973 original sequence version: 132 DIP protein P45973 original sequence version: 155 16FFC476367093B1 cbx1_human Chromobox protein homolog 1 CBX1 CBX Heterochromatin protein 1 homolog beta Modifier 1 protein M31 Heterochromatin protein p25 p25beta HP1Hsbeta protein protein human Homo sapiens Human MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN DIP protein P83916 original sequence version: 29 DIP protein P83916 original sequence version: 105 DIP protein P83916 original sequence version: 101 BE687AF9C66E48E3 incenp-cbx1-1 6 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association supplemental S1D incenp-cbx3-1 6 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association supplemental S1D incenp-cbx5-3 6 11 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association supplemental S1D cbx5-incenp-3 4 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P45973:p.Lys89_Lys91delinsGluGluGlu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain KRK EEE Thu Dec 08 14:30:15 GMT 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys89glu,arg90glu,lys91glu' Wed May 02 18:50:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys_arg_lys89-91glu_glu_glu' Tue Jun 30 19:48:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys89_Lys91delinsGluGluGlu' ecoli Escherichia coli (strain K12) physical association physical association 1A incenp-cbx5-4 6 11 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9NQS7:p.[Pro167Ala;Val169Ala;Ile171Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain I A Wed May 02 17:09:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro167ala,val169ala,ile171ala' Tue Jun 30 16:25:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro167Ala;Val169Ala;Ile171Ala]' physical association physical association 1B cbx5-incenp-4 3 11 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection P45973:p.Lys89_Lys91delinsGluGluGlu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain KRK EEE Tue Jan 24 14:08:16 GMT 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'lys89glu,arg90glu,lys91glu' Wed May 02 17:32:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys_arg_lys89-91glu_glu_glu' Tue Jun 30 17:55:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys89_Lys91delinsGluGluGlu' P45973:p.Trp174Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain W A Wed May 02 19:17:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp174ala' Tue Jun 30 16:43:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp174Ala' region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 tag fluorescence tag visualisation by fluorescence tag fluorescence tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region mcherry mcherry fluorescent protein tag mcherry undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 1C and 2A Colocalisation was observed during both interphase and mitosis in WT and KE mutant,; however the W174A mutant localized normally to centromeres in interphase but failed to localize to centromeres in mitosis. cbx1-sgo1-1 2 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role neutral component neutral component purified purified chromo/chromo_shadow_dom sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) direct interaction direct interaction 4B sgo1-cbx5-1 6 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection Q5FBB7:p.[Pro469Ala;Val471Ala;Leu473Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain L A Tue Jan 24 14:08:06 GMT 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'Pro469Ala, Vala471Ala, and Leu473Ala' Wed May 02 16:56:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro469ala,val471ala,leu473ala' Tue Jun 30 17:55:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro469Ala;Val471Ala;Leu473Ala]' Q5FBB7:p.[Pro451Ala;Val453Ala;Ile455Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain I A Wed May 02 16:15:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro451ala,val453ala,ile455ala' Tue Jun 30 19:06:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro451Ala;Val453Ala;Ile455Ala]' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4C cbx1-sgo1-2 1 7 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain synthetic construct synthetic construct 12 unspecified role unspecified role unspecified role unspecified role chromo/chromo_shadow_dom sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) physical association physical association Table S1 1.93A Rworking 18.9%, Rfree 23 % wtsetzg-1 5 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Supp 2A nocodazole:-a microtubule-destabilising agent increasing the proportion of mitotic cells.