IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The Journal of biological chemistry 2010 imex curation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. Dark space = ?40 CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-8387 human fibrosarcoma cell line 8387 Human 8387 fibrosarcoma cell line 8387 molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk Accepted 2016-AUG-09 AT 12:06 BST AT 12:06 BST by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation altered; Type altered to Direct. I assume I did not add TEM data from Fig 2 as it is stated "we could not use them for three-dimensional reconstructions." - unclear what the stoichiometry is. So I have added Fig 2 without any.; altered; altered; altered; altered; altered; altered, and added purified as well; altered: I have changed the stoichiometry so that FGF2 = 2 and PTX3 = 1 (was the other way around before); I think this is the missing interaction:Supp Fig 4 is "dissociation"; altered to direct, and purified added. ~New Expt added for CHO cell full length construct in Fig 4B. (Expt-17) The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The Journal of biological chemistry 2010 imex curation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. Dark space = ?40 CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk Accepted 2016-AUG-09 AT 12:06 BST AT 12:06 BST by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation altered; Type altered to Direct. I assume I did not add TEM data from Fig 2 as it is stated "we could not use them for three-dimensional reconstructions." - unclear what the stoichiometry is. So I have added Fig 2 without any.; altered; altered; altered; altered; altered; altered, and added purified as well; altered: I have changed the stoichiometry so that FGF2 = 2 and PTX3 = 1 (was the other way around before); I think this is the missing interaction:Supp Fig 4 is "dissociation"; altered to direct, and purified added. ~New Expt added for CHO cell full length construct in Fig 4B. (Expt-17) The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The Journal of biological chemistry 2010 imex curation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. Dark space = ?40 CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk Accepted 2016-AUG-09 AT 12:06 BST AT 12:06 BST by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation altered; Type altered to Direct. I assume I did not add TEM data from Fig 2 as it is stated "we could not use them for three-dimensional reconstructions." - unclear what the stoichiometry is. So I have added Fig 2 without any.; altered; altered; altered; altered; altered; altered, and added purified as well; altered: I have changed the stoichiometry so that FGF2 = 2 and PTX3 = 1 (was the other way around before); I think this is the missing interaction:Supp Fig 4 is "dissociation"; altered to direct, and purified added. ~New Expt added for CHO cell full length construct in Fig 4B. (Expt-17) The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The Journal of biological chemistry 2010 imex curation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. Dark space = ?40 CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. electrophoresis electrophoretic mobility-based method electrophoresis weight by comassie molecular weight estimation by coomasie staining weight by comassie Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk Accepted 2016-AUG-09 AT 12:06 BST AT 12:06 BST by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation altered; Type altered to Direct. I assume I did not add TEM data from Fig 2 as it is stated "we could not use them for three-dimensional reconstructions." - unclear what the stoichiometry is. So I have added Fig 2 without any.; altered; altered; altered; altered; altered; altered, and added purified as well; altered: I have changed the stoichiometry so that FGF2 = 2 and PTX3 = 1 (was the other way around before); I think this is the missing interaction:Supp Fig 4 is "dissociation"; altered to direct, and purified added. ~New Expt added for CHO cell full length construct in Fig 4B. (Expt-17) The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The Journal of biological chemistry 2010 imex curation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. Dark space = ?40 CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro solid phase assay solid phase assay tag visualisation tag visualisation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk Accepted 2016-AUG-09 AT 12:06 BST AT 12:06 BST by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation altered; Type altered to Direct. I assume I did not add TEM data from Fig 2 as it is stated "we could not use them for three-dimensional reconstructions." - unclear what the stoichiometry is. So I have added Fig 2 without any.; altered; altered; altered; altered; altered; altered, and added purified as well; altered: I have changed the stoichiometry so that FGF2 = 2 and PTX3 = 1 (was the other way around before); I think this is the missing interaction:Supp Fig 4 is "dissociation"; altered to direct, and purified added. ~New Expt added for CHO cell full length construct in Fig 4B. (Expt-17) The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The Journal of biological chemistry 2010 imex curation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. Dark space = ?40 CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk Accepted 2016-AUG-09 AT 12:06 BST AT 12:06 BST by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation altered; Type altered to Direct. I assume I did not add TEM data from Fig 2 as it is stated "we could not use them for three-dimensional reconstructions." - unclear what the stoichiometry is. So I have added Fig 2 without any.; altered; altered; altered; altered; altered; altered, and added purified as well; altered: I have changed the stoichiometry so that FGF2 = 2 and PTX3 = 1 (was the other way around before); I think this is the missing interaction:Supp Fig 4 is "dissociation"; altered to direct, and purified added. ~New Expt added for CHO cell full length construct in Fig 4B. (Expt-17) The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The Journal of biological chemistry 2010 imex curation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. Dark space = ?40 CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk Accepted 2016-AUG-09 AT 12:06 BST AT 12:06 BST by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation altered; Type altered to Direct. I assume I did not add TEM data from Fig 2 as it is stated "we could not use them for three-dimensional reconstructions." - unclear what the stoichiometry is. So I have added Fig 2 without any.; altered; altered; altered; altered; altered; altered, and added purified as well; altered: I have changed the stoichiometry so that FGF2 = 2 and PTX3 = 1 (was the other way around before); I think this is the missing interaction:Supp Fig 4 is "dissociation"; altered to direct, and purified added. ~New Expt added for CHO cell full length construct in Fig 4B. (Expt-17) The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The Journal of biological chemistry 2010 imex curation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. Dark space = ?40 CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-8387 human fibrosarcoma cell line 8387 Human 8387 fibrosarcoma cell line 8387 electrophoresis electrophoretic mobility-based method electrophoresis weight by comassie molecular weight estimation by coomasie staining weight by comassie Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk Accepted 2016-AUG-09 AT 12:06 BST AT 12:06 BST by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation altered; Type altered to Direct. I assume I did not add TEM data from Fig 2 as it is stated "we could not use them for three-dimensional reconstructions." - unclear what the stoichiometry is. So I have added Fig 2 without any.; altered; altered; altered; altered; altered; altered, and added purified as well; altered: I have changed the stoichiometry so that FGF2 = 2 and PTX3 = 1 (was the other way around before); I think this is the missing interaction:Supp Fig 4 is "dissociation"; altered to direct, and purified added. ~New Expt added for CHO cell full length construct in Fig 4B. (Expt-17) The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The Journal of biological chemistry 2010 imex curation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. Dark space = ?40 CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f electrophoresis electrophoretic mobility-based method electrophoresis weight by comassie molecular weight estimation by coomasie staining weight by comassie Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk Accepted 2016-AUG-09 AT 12:06 BST AT 12:06 BST by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation altered; Type altered to Direct. I assume I did not add TEM data from Fig 2 as it is stated "we could not use them for three-dimensional reconstructions." - unclear what the stoichiometry is. So I have added Fig 2 without any.; altered; altered; altered; altered; altered; altered, and added purified as well; altered: I have changed the stoichiometry so that FGF2 = 2 and PTX3 = 1 (was the other way around before); I think this is the missing interaction:Supp Fig 4 is "dissociation"; altered to direct, and purified added. ~New Expt added for CHO cell full length construct in Fig 4B. (Expt-17) The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The Journal of biological chemistry 2010 imex curation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. Dark space = ?40 CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk Accepted 2016-AUG-09 AT 12:06 BST AT 12:06 BST by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation altered; Type altered to Direct. I assume I did not add TEM data from Fig 2 as it is stated "we could not use them for three-dimensional reconstructions." - unclear what the stoichiometry is. So I have added Fig 2 without any.; altered; altered; altered; altered; altered; altered, and added purified as well; altered: I have changed the stoichiometry so that FGF2 = 2 and PTX3 = 1 (was the other way around before); I think this is the missing interaction:Supp Fig 4 is "dissociation"; altered to direct, and purified added. ~New Expt added for CHO cell full length construct in Fig 4B. (Expt-17) The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The Journal of biological chemistry 2010 imex curation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. Dark space = ?40 CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk Accepted 2016-AUG-09 AT 12:06 BST AT 12:06 BST by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation altered; Type altered to Direct. I assume I did not add TEM data from Fig 2 as it is stated "we could not use them for three-dimensional reconstructions." - unclear what the stoichiometry is. So I have added Fig 2 without any.; altered; altered; altered; altered; altered; altered, and added purified as well; altered: I have changed the stoichiometry so that FGF2 = 2 and PTX3 = 1 (was the other way around before); I think this is the missing interaction:Supp Fig 4 is "dissociation"; altered to direct, and purified added. ~New Expt added for CHO cell full length construct in Fig 4B. (Expt-17) The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The Journal of biological chemistry 2010 imex curation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. Dark space = ?40 CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk Accepted 2016-AUG-09 AT 12:06 BST AT 12:06 BST by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation altered; Type altered to Direct. I assume I did not add TEM data from Fig 2 as it is stated "we could not use them for three-dimensional reconstructions." - unclear what the stoichiometry is. So I have added Fig 2 without any.; altered; altered; altered; altered; altered; altered, and added purified as well; altered: I have changed the stoichiometry so that FGF2 = 2 and PTX3 = 1 (was the other way around before); I think this is the missing interaction:Supp Fig 4 is "dissociation"; altered to direct, and purified added. ~New Expt added for CHO cell full length construct in Fig 4B. (Expt-17) The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The Journal of biological chemistry 2010 imex curation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. Dark space = ?40 CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-8387 human fibrosarcoma cell line 8387 Human 8387 fibrosarcoma cell line 8387 tem transmission electron microscopy tem predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk Accepted 2016-AUG-09 AT 12:06 BST AT 12:06 BST by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation altered; Type altered to Direct. I assume I did not add TEM data from Fig 2 as it is stated "we could not use them for three-dimensional reconstructions." - unclear what the stoichiometry is. So I have added Fig 2 without any.; altered; altered; altered; altered; altered; altered, and added purified as well; altered: I have changed the stoichiometry so that FGF2 = 2 and PTX3 = 1 (was the other way around before); I think this is the missing interaction:Supp Fig 4 is "dissociation"; altered to direct, and purified added. ~New Expt added for CHO cell full length construct in Fig 4B. (Expt-17) The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The Journal of biological chemistry 2010 imex curation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. Dark space = ?40 CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. tem transmission electron microscopy tem predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk Accepted 2016-AUG-09 AT 12:06 BST AT 12:06 BST by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation altered; Type altered to Direct. I assume I did not add TEM data from Fig 2 as it is stated "we could not use them for three-dimensional reconstructions." - unclear what the stoichiometry is. So I have added Fig 2 without any.; altered; altered; altered; altered; altered; altered, and added purified as well; altered: I have changed the stoichiometry so that FGF2 = 2 and PTX3 = 1 (was the other way around before); I think this is the missing interaction:Supp Fig 4 is "dissociation"; altered to direct, and purified added. ~New Expt added for CHO cell full length construct in Fig 4B. (Expt-17) The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The Journal of biological chemistry 2010 imex curation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. Dark space = ?40 CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk Accepted 2016-AUG-09 AT 12:06 BST AT 12:06 BST by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation altered; Type altered to Direct. I assume I did not add TEM data from Fig 2 as it is stated "we could not use them for three-dimensional reconstructions." - unclear what the stoichiometry is. So I have added Fig 2 without any.; altered; altered; altered; altered; altered; altered, and added purified as well; altered: I have changed the stoichiometry so that FGF2 = 2 and PTX3 = 1 (was the other way around before); I think this is the missing interaction:Supp Fig 4 is "dissociation"; altered to direct, and purified added. ~New Expt added for CHO cell full length construct in Fig 4B. (Expt-17) The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The Journal of biological chemistry 2010 imex curation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. Dark space = ?40 CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk Accepted 2016-AUG-09 AT 12:06 BST AT 12:06 BST by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation altered; Type altered to Direct. I assume I did not add TEM data from Fig 2 as it is stated "we could not use them for three-dimensional reconstructions." - unclear what the stoichiometry is. So I have added Fig 2 without any.; altered; altered; altered; altered; altered; altered, and added purified as well; altered: I have changed the stoichiometry so that FGF2 = 2 and PTX3 = 1 (was the other way around before); I think this is the missing interaction:Supp Fig 4 is "dissociation"; altered to direct, and purified added. ~New Expt added for CHO cell full length construct in Fig 4B. (Expt-17) The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2. The Journal of biological chemistry 2010 imex curation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. Dark space = ?40 CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. saxs x ray scattering saxs predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. apologies if there are missing or duplicated interactions:- editor was deleting/adding interactions - not as I intended and although I have tried to remedy, may not have succeeded. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk Accepted 2016-AUG-09 AT 12:06 BST AT 12:06 BST by ORCHARD The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation altered; Type altered to Direct. I assume I did not add TEM data from Fig 2 as it is stated "we could not use them for three-dimensional reconstructions." - unclear what the stoichiometry is. So I have added Fig 2 without any.; altered; altered; altered; altered; altered; altered, and added purified as well; altered: I have changed the stoichiometry so that FGF2 = 2 and PTX3 = 1 (was the other way around before); I think this is the missing interaction:Supp Fig 4 is "dissociation"; altered to direct, and purified added. ~New Expt added for CHO cell full length construct in Fig 4B. (Expt-17) fgf2_human Fibroblast growth factor 2 Basic fibroblast growth factor FGF2 FGFB Heparin-binding growth factor 2 protein protein human Homo sapiens Human MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS DIP protein P09038 original sequence version: 169 DIP protein P09038 original sequence version: 129 EAE98552A39D5E19 ptx3_human Pentraxin-related protein PTX3 Pentaxin-related protein PTX3 TNFAIP5 TSG14 Tumor necrosis factor alpha-induced protein 5 Tumor necrosis factor-inducible gene 14 protein PTX3 protein protein human Homo sapiens Human MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACGQEHSEWDKLFIMLENSQMRERMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDELLQATRDAGRRLARMEGAEAQRPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCETAILFPMRSKKIFGSVHPVRPMRLESFSACIWVKATDVLNKTILFSYGTKRNPYEIQLYLSYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS 09BCE02E2A62D62A ptx3-26 16 19 unspecified role unspecified role neutral component neutral component direct interaction direct interaction 1 Material isolated from a much smaller peak indicated that this species is composed of 16 promoter subunits. ptx3-15 17 19 unspecified role unspecified role neutral component neutral component crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 3 The protein is composed of four globular domains (each with a diameter of ∼4 nm) arranged into tetramers. ptx3-16 9 19 unspecified role unspecified role neutral component neutral component purified purified P26022:p.[Cys47Ser;Cys49Ser;Cys103Ser] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Fri Jul 22 10:52:47 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys103ser,cys47ser,cys49ser' Wed May 02 20:07:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys47ser,cys49ser,cys103ser' Tue Jun 30 20:21:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys47Ser;Cys49Ser;Cys103Ser]' c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction 4B, 5A The C_PTX3 fragment does not oligomerise. ptx3-17 9 19 unspecified role unspecified role neutral component neutral component purified purified P26022:p.Cys103Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 16:26:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys103ser' Tue Jun 30 18:03:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys103Ser' P26022:p.[Cys47Ser;Cys49Ser] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:21:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys47ser,cys49ser' Tue Jun 30 18:14:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys47Ser;Cys49Ser]' c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction 4Bi, 5A The C_PTX3 fragment does not oligomerise. ptx3-21 3 19 unspecified role unspecified role neutral component neutral component P26022:p.[Cys47Ser;Cys49Ser;Cys103Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Fri Jul 22 11:09:08 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys103ser,cys47ser,cys49ser' Wed May 02 17:09:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys47ser,cys49ser,cys103ser' Tue Jun 30 15:37:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys47Ser;Cys49Ser;Cys103Ser]' c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction 5B Non-covalent associations between N_PTX3 monomers mediate dimerization. ptx3-19 11 19 unspecified role unspecified role neutral component neutral component P26022:p.Cys103Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 19:06:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys103ser' Tue Jun 30 16:20:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys103Ser' P26022:p.[Cys47Ser;Cys49Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 16:47:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys47ser,cys49ser' Tue Jun 30 18:01:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys47Ser;Cys49Ser]' c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction 5C ptx3-18 3 19 unspecified role unspecified role neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P26022:p.Cys103Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:05:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys103ser' Tue Jun 30 17:20:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys103Ser' P26022:p.[Cys47Ser;Cys49Ser] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:32:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys47ser,cys49ser' Tue Jun 30 19:21:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys47Ser;Cys49Ser]' direct interaction direct interaction 4Ci, 5B The single and double mutant proteins both corresponded to a mixture of tetramers and dimers ptx3-20 3 19 unspecified role unspecified role neutral component neutral component P26022:p.[Cys47Ser;Cys49Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:02:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys47ser,cys49ser' Tue Jun 30 16:45:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys47Ser;Cys49Ser]' P26022:p.Cys103Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 16:06:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys103ser' Tue Jun 30 18:10:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys103Ser' c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction 5Bi 89yuih-1 6 18 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role neutral component neutral component crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 7A, Supp 2B fgf2-ptx3-8 10 18 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role neutral component neutral component crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 7B to me, the results dont look much different between with and without FGF2.. 243-1 2 18 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 7D fgf2-ptx3-7 2 18 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P26022:p.Cys103Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:16:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys103ser' Tue Jun 30 18:24:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys103Ser' P26022:p.[Cys47Ser;Cys49Ser;Cys103Ser] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Fri Jul 22 10:49:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys103ser, cys47ser,cys49ser' Wed May 02 17:13:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys47ser,cys49ser,cys103ser' Tue Jun 30 20:19:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys47Ser;Cys49Ser;Cys103Ser]' human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction 7Di, Supp 7A fgf2-ptx3-9 5 18 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 19 competitor competitor competitor prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P26022:p.[Cys47Ser;Cys49Ser;Cys103Ser] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Fri Jul 22 10:52:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys47ser,cys49ser' Wed May 02 15:38:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys47ser,cys49ser,cys103ser' Tue Jun 30 20:11:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys47Ser;Cys49Ser;Cys103Ser]' region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P26022:p.Cys103Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:13:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys103ser' Tue Jun 30 17:58:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys103Ser' human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 19 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 7Eii, Supp 7B fgf2-ptx3-10 5 18 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 7E fgf2-ptx3-11 5 19 competitor competitor competitor prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 18 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 7Ei fgf2-ptx3-12 7 18 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction 7F Both the disulfide-linked tetramer (4-mer) and disulfide-linked dimer (2-mer), bound to bFGF2 fgf2-ptx3-13 12 19 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction Supp 2A ptx3-22 8 19 unspecified role unspecified role neutral component neutral component physical association physical association Supp 3A Stoichiometry has been inferred by similarity to the purified recombinant protein. ptx3-23 1 19 unspecified role unspecified role neutral component neutral component physical association physical association Supp 3B Stoichiometry has been inferred by similarity to the purified recombinant protein. ptx3-24 6 19 unspecified role unspecified role neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction Supp 4 ptx3-25 6 19 unspecified role unspecified role neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction Supp 4 fgf2-ptx3-14 7 18 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction 7F Both the disulfide-linked tetramer (4-mer) and disulfide-linked dimer (2-mer), bound to bFGF2 ptx3-27 14 19 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component direct interaction direct interaction 2 The protein is composed of four globular domains arranged into tetramers. ptx3-ptx3-1 13 19 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component direct interaction direct interaction Supp fig 3 C/D The protein is composed of four globular domains arranged into tetramers. 5qsdf-1 4 19 unspecified role unspecified role neutral component neutral component purified purified 19 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction 4B Molecular weight was greater than 210kDa. ptx3-28 15 19 unspecified role unspecified role neutral component neutral component purified purified c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Supp 2A The C_PTX3 fragment does not oligomerise.