IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SOSS complexes participate in the maintenance of genomic stability. SOSS complexes participate in the maintenance of genomic stability. Molecular cell 2009 imex curation Huang J., Gong Z., Ghosal G., Chen J. Junjie.Chen@yale.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa tag visualisation tag visualisation Huang J., Gong Z., Ghosal G., Chen J. Junjie.Chen@yale.edu Accepted 2016-SEP-06 AT 08:05 BST AT 08:05 BST by ORCHARD Molecular cell 2009 Only protein-protein interactions imex curation imex curation SOSS complexes participate in the maintenance of genomic stability. SOSS complexes participate in the maintenance of genomic stability. Molecular cell 2009 imex curation Huang J., Gong Z., Ghosal G., Chen J. Junjie.Chen@yale.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Huang J., Gong Z., Ghosal G., Chen J. Junjie.Chen@yale.edu Accepted 2016-SEP-06 AT 08:05 BST AT 08:05 BST by ORCHARD Molecular cell 2009 Only protein-protein interactions imex curation imex curation SOSS complexes participate in the maintenance of genomic stability. SOSS complexes participate in the maintenance of genomic stability. Molecular cell 2009 imex curation Huang J., Gong Z., Ghosal G., Chen J. Junjie.Chen@yale.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Huang J., Gong Z., Ghosal G., Chen J. Junjie.Chen@yale.edu Accepted 2016-SEP-06 AT 08:05 BST AT 08:05 BST by ORCHARD Molecular cell 2009 Only protein-protein interactions imex curation imex curation SOSS complexes participate in the maintenance of genomic stability. SOSS complexes participate in the maintenance of genomic stability. Molecular cell 2009 imex curation Huang J., Gong Z., Ghosal G., Chen J. Junjie.Chen@yale.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Huang J., Gong Z., Ghosal G., Chen J. Junjie.Chen@yale.edu Accepted 2016-SEP-06 AT 08:05 BST AT 08:05 BST by ORCHARD Molecular cell 2009 Only protein-protein interactions imex curation imex curation SOSS complexes participate in the maintenance of genomic stability. SOSS complexes participate in the maintenance of genomic stability. Molecular cell 2009 imex curation Huang J., Gong Z., Ghosal G., Chen J. Junjie.Chen@yale.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Huang J., Gong Z., Ghosal G., Chen J. Baculovirus constructs were expressed in SF9 cells and purified on GST-Sepharose and Ni-NTA-beads. Double-purified complexes were then run on get filtration column. Junjie.Chen@yale.edu Accepted 2016-SEP-06 AT 08:05 BST AT 08:05 BST by ORCHARD Molecular cell 2009 Only protein-protein interactions imex curation imex curation Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method SOSS complexes participate in the maintenance of genomic stability. SOSS complexes participate in the maintenance of genomic stability. Molecular cell 2009 imex curation Huang J., Gong Z., Ghosal G., Chen J. Junjie.Chen@yale.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection pull down pull down western blot western blot Immuno blot Immuno blot Huang J., Gong Z., Ghosal G., Chen J. Junjie.Chen@yale.edu Accepted 2016-SEP-06 AT 08:05 BST AT 08:05 BST by ORCHARD Molecular cell 2009 Only protein-protein interactions imex curation imex curation SOSS complexes participate in the maintenance of genomic stability. SOSS complexes participate in the maintenance of genomic stability. Molecular cell 2009 imex curation Huang J., Gong Z., Ghosal G., Chen J. Junjie.Chen@yale.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down ms participant Identification by mass spectrometry ms participant Huang J., Gong Z., Ghosal G., Chen J. The affinity complexes also contained Tubulin and Histone 1 but these could not be mapped to a single gene product. Junjie.Chen@yale.edu Accepted 2016-SEP-06 AT 08:05 BST AT 08:05 BST by ORCHARD Molecular cell 2009 Only protein-protein interactions imex curation imex curation nbn_human Nibrin Nijmegen breakage syndrome protein 1 Cell cycle regulatory protein p95 NBN NBS1 NBS P95 protein protein human Homo sapiens Human MWKLLPAAGPAGGEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLSQTDEIPVLTLKDNSKYGTFVNEEKMQNGFSRTLKSGDGITFGVFGSKFRIEYEPLVACSSCLDVSGKTALNQAILQLGGFTVNNWTEECTHLVMVSVKVTIKTICALICGRPIVKPEYFTEFLKAVESKKQPPQIESFYPPLDEPSIGSKNVDLSGRQERKQIFKGKTFIFLNAKQHKKLSSAVVFGGGEARLITEENEEEHNFFLAPGTCVVDTGITNSQTLIPDCQKKWIQSIMDMLQRQGLRPIPEAEIGLAVIFMTTKNYCDPQGHPSTGLKTTTPGPSLSQGVSVDEKLMPSAPVNTTTYVADTESEQADTWDLSERPKEIKVSKMEQKFRMLSQDAPTVKESCKTSSNNNSMVSNTLAKMRIPNYQLSPTKLPSINKSKDRASQQQQTNSIRNYFQPSTKKRERDEENQEMSSCKSARIETSCSLLEQTQPATPSLWKNKEQHLSENEPVDTNSDNNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIEDEVLEQLFKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR DIP protein O60934 original sequence version: 65 DIP protein O60934 original sequence version: 84 DIP protein O60934 original sequence version: 96 DIP protein O60934 original sequence version: 131 DIP protein O60934 original sequence version: 133 DIP protein O60934 original sequence version: 128 DIP protein O60934 original sequence version: 99 DIP protein O60934 original sequence version: 85 CD602F09BA73DAB6 hnrh1_human Heterogeneous nuclear ribonucleoprotein H HNRNPH1 HNRPH HNRPH1 protein protein human Homo sapiens Human MMLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYNGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSTFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEDAVAAMSKDKANMQHRYVELFLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQENSSDFQSNIA 4ECF7A075C2526FF d60t EMSA probe of 60 thymidines ss dna single stranded deoxyribonucleic acid ss DNA ss dna chemical synthesis Chemical synthesis (Chemical synthesis) TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT sossc_human SOSS complex subunit C INIP C9orf80 INTS3- and NABP-interacting protein SSBIP1 Sensor of single-strand DNA complex subunit C Sensor of ssDNA subunit C Single-stranded DNA-binding protein-interacting protein 1 HSPC043 HSPC291 protein protein human Homo sapiens Human MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE 87B2467920C58C1E sosb1_human SOSS complex subunit B1 NABP2 Nucleic acid-binding protein 2 OBFC2B Oligonucleotide/oligosaccharide-binding fold-containing protein 2B SSB1 Sensor of single-strand DNA complex subunit B1 Sensor of ssDNA subunit B1 Single-stranded DNA-binding protein 1 LP3587 protein protein human Homo sapiens Human MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGPSAASPASENQNGNGLSAPPGPGGGPHPPHTPSHPPSTRITRSQPNHTPAGPPGPSSNPVSNGKETRRSSKR B72014397B7947E2 prdx1_human Peroxiredoxin-1 PRDX1 PAGA PAGB TDPX2 Thioredoxin peroxidase 2 Thioredoxin-dependent peroxide reductase 2 Proliferation-associated gene protein Natural killer cell-enhancing factor A Thioredoxin-dependent peroxiredoxin 1 protein protein human Homo sapiens Human MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK DIP protein Q06830 original sequence version: 144 DIP protein Q06830 original sequence version: 180 8F68E56D75BF5304 int3_human Integrator complex subunit 3 INTS3 C1orf193 C1orf60 SOSS complex subunit A Sensor of single-strand DNA complex subunit A protein protein human Homo sapiens Human MELQKGKGAAAAAAASGAAGGGGGGAGAGAPGGGRLLLSTSLDAKDELEERLERCMSIVTSMTAGVSEREANDALNAYVCKGLPQHEEICLGLFTLILTEPAQAQKCYRDLALVSRDGMNIVLNKINQILMEKYLKLQDTCRTQLVWLVRELVKSGVLGADGVCMTFMKQIAGGGDVTAKNIWLAESVLDILTEQREWVLKSSILIAMAVYTYLRLIVDHHGTAQLQALRQKEVDFCISLLRERFMECLMIGRDLVRLLQNVARIPEFELLWKDIIHNPQALSPQFTGILQLLQSRTSRKFLACRLTPDMETKLLFMTSRVRFGQQKRYQDWFQRQYLSTPDSQSLRCDLIRYICGVVHPSNEVLSSDILPRWAIIGWLLTTCTSNVAASNAKLALFYDWLFFSPDKDSIMNIEPAILVMHHSMKPHPAITATLLDFMCRIIPNFYPPLEGHVRQGVFSSLNHIVEKRVLAHLAPLFDNPKLDKELRAMLREKFPEFCSSPSPPVEVKIEEPVSMEMDNHMSDKDESCYDNAEAAFSDDEEDLNSKGKKREFRFHPIKETVVEEPVDITPYLDQLDESLRDKVLQLQKGSDTEAQCEVMQEIVDQVLEEDFDSEQLSVLASCLQELFKAHFRGEVLPEEITEESLEESVGKPLYLIFRNLCQMQEDNSSFSLLLDLLSELYQKQPKIGYHLLYYLRASKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLCHLTPSIYTEFPDETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQSLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRREKPSEEMVKMVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIKSLLIKNNSLPRKRQSLRSSSSKLAQLTLEQILEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQPPNAEEESGSSSASEEEDTKPKPTKRKRKGSSAVGSDSD 66A49C646077C3F4 odb2_human Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial DBT BCATE2 Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase Dihydrolipoamide branched chain transacylase Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex Branched-chain alpha-keto acid dehydrogenase complex component E2 52 kDa mitochondrial autoantigen of primary biliary cirrhosis Branched chain 2-oxo-acid dehydrogenase complex component E2 protein protein human Homo sapiens Human MAAVRMLRTWSRNAGKLICVRYFQTCGNVHVLKPNYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK A7CA728C8F33D126 sosb2_human SOSS complex subunit B2 NABP1 Nucleic acid-binding protein 1 OBFC2A Oligonucleotide/oligosaccharide-binding fold-containing protein 2A SSB2 Sensor of single-strand DNA complex subunit B2 Sensor of ssDNA subunit B2 Single-stranded DNA-binding protein 2 protein protein human Homo sapiens Human MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR EF7579A452381E47 nabp2-dbt-1 8 12 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait S-protein-flag-streptavidin-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey association association Fig. 1a nabp1-dbt-1 8 12 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait S-protein-flag-streptavidin-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 16 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey association association Fig. 1a ints3-inip-1 2 17 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait association association Fig. 1b Irradiating the cells with 10Gy did not affect the interaction. inip-ints3-1 2 17 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey association association Fig. 1b Irradiating the cells with 10Gy did not affect the interaction. nabp2-inip-1 2 12 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association Fig. 1b Irradiating the cells with 10Gy did not affect the interaction. nabp1-inip-1 2 12 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association Fig. 1b Irradiating the cells with 10Gy did not affect the interaction. nabp2-ints3-1 4 13 unspecified role unspecified role bait bait s-protein-flag-steptavidin tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. S1, Lane 5 nabp1-ints3-1 4 17 unspecified role unspecified role bait bait s-protein-flag-steptavidin tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. S1, Lane 4 inip-ints3-2 4 12 unspecified role unspecified role bait bait s-protein-flag-steptavidin tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. S1, Lane 7 nabp2-inip-2 5 12 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role neutral component neutral component gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1c d60t-soss2_complex-1 1 11 unspecified role unspecified role bait bait 31p-labeled 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 75 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction Fig. S2b (right) d60t-nabp2-1 1 13 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 11 unspecified role unspecified role bait bait 31p-labeled 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig. S2b (left) ints3-nabp2-1 7 13 unspecified role unspecified role prey prey his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1d (left) ints3-inip-2 7 12 unspecified role unspecified role prey prey s-protein-flag-steptavidin tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1d (right) ints3-nabp2-2 3 13 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 15 unspecified role unspecified role bait bait s-protein-flag-steptavidin tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction Fig. 1f (left) ints3-nabp1-1 3 17 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 15 unspecified role unspecified role bait bait s-protein-flag-steptavidin tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction Fig. 1f (left) inip-ints3-3 3 12 unspecified role unspecified role bait bait s-protein-flag-steptavidin tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 15 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction Fig. 1f (right) nbn-ints3-1 4 9 unspecified role unspecified role bait bait s-protein-flag-steptavidin tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. S5a ints3-nbn-1 7 9 unspecified role unspecified role prey prey s-protein-flag-steptavidin tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. S5b inip-ints3-nabp1_human sensor of ssDNA IMS2 SOSS2 complex INIP:INTS3:NABP1 INTS3-NABP1-C9orf80 complex INTS3-NABP1-SSBIP1 complex SOSSA-SOSSB2-SOSSC complex 17 unspecified role unspecified role INTS3 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role INTS3 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role NABP1 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain INIP binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 119 123 124 121 physical association physical association human Homo sapiens Human stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction A double-stranded DNA break repair complex that senses single-stranded DNA (ssDNA) and promotes repair of DNA double-strand breaks (DSBs). The binding affinity for ssDNA becomes more significant the longer the ssDNA fragment is. Influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation (G2/M), homologous recombination-dependent repair of DSBs, ATM-dependent signaling pathways and maintenance of genomic stability. The SOSSA (INT3) subunit promotes nuclear localization of the complex. Heterotrimer SOSSB2 binds to the ssDNA through a surface that is distinct from the SOSSA binding interface. Accepted 2016-AUG-15 by ORCHARD