UniProt UniProt http://www.uniprot.org Involvement of an inner nuclear membrane protein, Nemp1, in Xenopus neural development through an interaction with the chromatin protein BAF. Involvement of an inner nuclear membrane protein, Nemp1, in Xenopus neural development through an interaction with the chromatin protein BAF. Developmental biology 2009 imex curation Mamada H., Takahashi N., Taira M. m_taira@bs.s.u-tokyo.ac.jp 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions xenla-embryo Xenopus laevis embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. confocal microscopy confocal microscopy immunostaining immunostaining Mamada H., Takahashi N., Taira M. m_taira@bs.s.u-tokyo.ac.jp Accepted 2016-DEC-15 AT 15:03 GMT AT 15:03 GMT by ORCHARD Developmental biology 2009 imex curation Involvement of an inner nuclear membrane protein, Nemp1, in Xenopus neural development through an interaction with the chromatin protein BAF. Involvement of an inner nuclear membrane protein, Nemp1, in Xenopus neural development through an interaction with the chromatin protein BAF. Developmental biology 2009 imex curation Mamada H., Takahashi N., Taira M. m_taira@bs.s.u-tokyo.ac.jp 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy immunostaining immunostaining Mamada H., Takahashi N., Taira M. m_taira@bs.s.u-tokyo.ac.jp Accepted 2016-DEC-15 AT 15:03 GMT AT 15:03 GMT by ORCHARD Developmental biology 2009 imex curation Involvement of an inner nuclear membrane protein, Nemp1, in Xenopus neural development through an interaction with the chromatin protein BAF. Involvement of an inner nuclear membrane protein, Nemp1, in Xenopus neural development through an interaction with the chromatin protein BAF. Developmental biology 2009 imex curation Mamada H., Takahashi N., Taira M. m_taira@bs.s.u-tokyo.ac.jp 21-Mar-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Mamada H., Takahashi N., Taira M. Origin of lemd3/ XMAN1 according Osada et al., 2003 (PMID 12642484). m_taira@bs.s.u-tokyo.ac.jp Accepted 2016-DEC-15 AT 15:03 GMT AT 15:03 GMT by ORCHARD Developmental biology 2009 imex curation nmp1a_xenla Nuclear envelope integral membrane protein 1a nemp1a tmem194a-a protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAGDVEGGGCRVSWGALLTLLLLPLPSLCTLASGKEPHVIKLYEGKVVRYNESKNFCYQRTYEPKWSDVWTKIQIRVNSTKMIRVTQVENEEKLKEMETFNMFDLFSSFLKEKLNDTFIYVDLYSNKTCIKVHVIDTDTYYSVALSRGFDPRLCFLFLCGLLLFFYGDALSRSQLFFYSTGITIGMLASMLILVFMLSKLMPKKSPFVALLLGGWSVSIYIIQLVFKNLQAICSEYWQYLLGYLGIVGFVSFAFCYKYGPLENDRSINILTWTLQLIGLLLMYISVQIQHIAVTMVVIAFCTKQIEYPVQWIYILYRKIKRKRAKPSPPRLLTEEEYRKQGEIETRKALEELRGYCSSPDFATWKMISRIQSPKRFADFVEGSSHLTPNEVSVHEHEYGLGGSFLEDELFGEDSDIEVEMDIEQPLYLVPRSCF 26654FADC60FB8A1 bafb_xenla Barrier-to-autointegration factor B banf1-b baf-b protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSSTSQKHRDFVAEPMGEKSVQCLAGIGDTLGRRLEEKGFDKAYVVLGQFLVLKKDEELFKEWLKDACSANAKQSRDCYGCLKEWCDAFL 7F630D18484A0710 q7ztb4_xenla lemd3.S XMAN1 lemd3 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAAAQLTDEELFSELKRSGIMPGPVTDSTRPVYLKKLKKLREEQRLRHGKVRVITNNNTVAAPSESEGILKSGGDVTHKRYSRQSLAREAGKPSPILGFSSDESDVDAGLGAHGSRRSRTNTPQPERKSPVQHQPGTADANADRRKVPGWWEMRRPRGDSEEDDDDEEEGTEEASNCRTMNGSRHSYCRDYSDTDEEEQLGQDEQASRRSRRGSSKQAKEQSLDRDELAAWPGWSREVAGVSHRHRGAARKSHTAADTDGAGNLKRKSNNHLESGYNKDPPRVYFPSNSLPPRMPQSNHTAAPNHTKYSHYHYPDSKRQHHKVAEPEEALLQQFKRDEVSAAGRFSAHYLSMFLLTAACLFFLLLGLTYLRMRGTSLPANENLTSTEDLNVDSKKNLMNTLQKLHEKLSKTAGDYICGNTDHRNISVQEAKQYLRTLGQEYENEFNNTLAWILEHSATRDIGIKCVSDPGSILNITSVKYLESTLPKMSFMCRIKRAVITVAHRSSILLVGVGVLFGVWRYIKYRWAKEEEETKQMYDMVVKIIDVLKSHNEACQENKGLEPYTPIPHVRDSLILPQDRKKMKKVWDRAVEFLDANESRVRTETQKIGGADFQVWKWIQPSSTCDKISVMPSKVWQGQAFHLDRRNSPPNSLTPCLKIRNMFDPVMEIGDHWDLAIQEAILEKCSDNEGIVHIAVDKNSREGCVYVKCLSPEFAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQALTCSTPLKPSNTHMNSLLHLNLRTGTSNSQSCC 6387BEC34EE60EEB nemp1a-banf1_b-1 3 5 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range xenla-embryo Xenopus laevis embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 7B lemd3-banf1_b-1 3 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range xenla-embryo Xenopus laevis embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. physical association physical association 7B nemp1a-banf1_b-2 2 5 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 7C banf1_b-nemp1a-1 1 5 unspecified role unspecified role neutral component neutral component microinjection microinjection micro-injection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role neutral component neutral component microinjection microinjection micro-injection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 7D