UniProt UniProt http://www.uniprot.org Nrarp coordinates endothelial Notch and Wnt signaling to control vessel density in angiogenesis. Nrarp coordinates endothelial Notch and Wnt signaling to control vessel density in angiogenesis. Developmental cell 2009 imex curation Phng LK., Potente M., Leslie JD., Babbage J., Nyqvist D., Lobov I., Ondr JK., Rao S., Lang RA., Thurston G., Gerhardt H., Gerhardt H. holger.gerhardt@cancer.org.uk 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions human-uvec Human Umbilical Vein Endothelial Cells (HUVEC) huvec umbilical_vein_endothelium Umbilical vein endothelial cell [Umbilical vein endothelium] anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Phng LK., Potente M., Leslie JD., Babbage J., Nyqvist D., Lobov I., Ondr JK., Rao S., Lang RA., Thurston G., Gerhardt H., Gerhardt H. holger.gerhardt@cancer.org.uk Accepted 2016-FEB-04 AT 12:08 GMT AT 12:08 GMT by ORCHARD Developmental cell 2009 imex curation nrarp_mouse Notch-regulated ankyrin repeat-containing protein Nrarp protein protein mouse Mus musculus Mouse MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR C8B84B648DB47F4F lef1_human Lymphoid enhancer-binding factor 1 LEF1 T cell-specific transcription factor 1-alpha protein protein human Homo sapiens Human MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI DIP protein Q9UJU2 original sequence version: 136 DIP protein Q9UJU2 original sequence version: 73 D480D440698EEFE3 lef1-nrarp-1 1 2 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait physical association physical association 6H