IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ MAPPIT analysis of TLR adaptor complexes. MAPPIT analysis of TLR adaptor complexes. FEBS letters 2007 imex curation Ulrichts P., Peelman F., Beyaert R., Tavernier J. Primers: these do give some results for TIR domains - but these have not much relationship to UniProt mapping so have only entered these as ?-? No idea how to decipher Table 2 results, and very difficult to read/see results from Figures. If there was any other "Supplementary" Material I could not access it (Page not found) - other than the "Supporting Info" at the bottom. ("Prize" for the "most unclear publication of the year?) Dark space = no 21? Primers show that all constructs -where a genomic match could be determined, the species origin was Human. TLR primer sets were obtained from Human cell line MRC5. Jan.Tavernier@Ugent.be 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ulrichts P., Peelman F., Beyaert R., Tavernier J. Primers: these do give some results for TIR domains - but these have not much relationship to UniProt mapping so have only entered these as ?-? No idea how to decipher Table 2 results, and very difficult to read/see results from Figures. If there was any other "Supplementary" Material I could not access it (Page not found) - other than the "Supporting Info" at the bottom. ("Prize" for the "most unclear publication of the year?) Primers show that all constructs -where a genomic match could be determined, the species origin was Human. TLR primer sets were obtained from Human cell line MRC5. Jan.Tavernier@Ugent.be Accepted 2016-MAY-20 AT 14:22 BST AT 14:22 BST by ORCHARD FEBS letters 2007 Only protein-protein interactions imex curation imex curation MAPPIT analysis of TLR adaptor complexes. MAPPIT analysis of TLR adaptor complexes. FEBS letters 2007 imex curation Ulrichts P., Peelman F., Beyaert R., Tavernier J. Primers: these do give some results for TIR domains - but these have not much relationship to UniProt mapping so have only entered these as ?-? No idea how to decipher Table 2 results, and very difficult to read/see results from Figures. If there was any other "Supplementary" Material I could not access it (Page not found) - other than the "Supporting Info" at the bottom. ("Prize" for the "most unclear publication of the year?) Dark space = no 21? Primers show that all constructs -where a genomic match could be determined, the species origin was Human. TLR primer sets were obtained from Human cell line MRC5. Jan.Tavernier@Ugent.be 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. mappit mammalian protein protein interaction trap mappit predetermined predetermined participant predetermined Ulrichts P., Peelman F., Beyaert R., Tavernier J. Primers: these do give some results for TIR domains - but these have not much relationship to UniProt mapping so have only entered these as ?-? No idea how to decipher Table 2 results, and very difficult to read/see results from Figures. If there was any other "Supplementary" Material I could not access it (Page not found) - other than the "Supporting Info" at the bottom. ("Prize" for the "most unclear publication of the year?) Primers show that all constructs -where a genomic match could be determined, the species origin was Human. TLR primer sets were obtained from Human cell line MRC5. Jan.Tavernier@Ugent.be Accepted 2016-MAY-20 AT 14:22 BST AT 14:22 BST by ORCHARD FEBS letters 2007 Only protein-protein interactions imex curation imex curation tirap_human Toll/interleukin-1 receptor domain-containing adapter protein MyD88 adapter-like protein Adaptor protein Wyatt TIRAP MAL protein protein human Homo sapiens Human MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS DIP protein P58753 original sequence version: 119 44A8454D04704540 tcam2_human TIR domain-containing adapter molecule 2 TRIF-related adapter molecule Toll/interleukin-1 receptor domain-containing protein Toll-like receptor adaptor protein 3 Putative NF-kappa-B-activating protein 502 TICAM2 TIRP TIRAP3 TRAM protein protein human Homo sapiens Human MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQEGAQSVEEMFEEEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQHLQNLDDAVNGSAWTILLLTENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPLPRERTPFALQTINALEEESRGFPTQVERIFQESVYKTQQTIWKETRNMVQRQFIA 2D1171F9B04D9C4C sarm1_human NAD(+) hydrolase SARM1 Sterile alpha and Armadillo repeat protein Sterile alpha motif domain-containing protein 2 Tir-1 homolog SARM1 KIAA0524 SAMD2 SARM NADP(+) hydrolase SARM1 Sterile alpha and TIR motif-containing protein 1 protein protein human Homo sapiens Human MVLTLLLSAYKLCRFFAMSGPRPGAERLAVPGPDGGGGTGPWWAAGGRGPREVSPGAGTEVQDALERALPELQQALSALKQAGGARAVGAGLAEVFQLVEEAWLLPAVGREVAQGLCDAIRLDGGLDLLLRLLQAPELETRVQAARLLEQILVAENRDRVARIGLGVILNLAKEREPVELARSVAGILEHMFKHSEETCQRLVAAGGLDAVLYWCRRTDPALLRHCALALGNCALHGGQAVQRRMVEKRAAEWLFPLAFSKEDELLRLHACLAVAVLATNKEVEREVERSGTLALVEPLVASLDPGRFARCLVDASDTSQGRGPDDLQRLVPLLDSNRLEAQCIGAFYLCAEAAIKSLQGKTKVFSDIGAIQSLKRLVSYSTNGTKSALAKRALRLLGEEVPRPILPSVPSWKEAEVQTWLQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYSTCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGRSSRDSSAGSDTSLEGAAPMGPT 6391EA4C31EF6604 myd88_human Myeloid differentiation primary response protein MyD88 MYD88 protein protein human Homo sapiens Human MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP CEAE3F6B99524333 tlr4_human Toll-like receptor 4 TLR4 hToll protein protein human Homo sapiens Human MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI 92C48F55821133E8 tlr2_human Toll-like receptor 2 Toll/interleukin-1 receptor-like protein 4 TLR2 TIL4 protein protein human Homo sapiens Human MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLSNNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDNDRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLKSLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDISKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS DIP protein O60603 original sequence version: 92 DIP protein O60603 original sequence version: 114 7DBE6B24CF1FAF8B tirap-myd88-2 2 6 unspecified role unspecified role prey prey tir sufficient to bind sufficient binding region sufficient to bind range range range range Q99836:p.Pro200His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P H Wed May 02 15:43:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro200his' Tue Jun 30 18:03:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro200His' 3 unspecified role unspecified role bait bait tir sufficient to bind sufficient binding region sufficient to bind range range range range P58753:p.Pro125His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P H Wed May 02 16:42:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro125his' Tue Jun 30 20:19:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro125His' physical association physical association 2A-1 tirap-myd88-3 2 3 unspecified role unspecified role prey prey tir sufficient to bind sufficient binding region sufficient to bind range range range range P58753:p.Pro125His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P H Wed May 02 16:23:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro125his' Tue Jun 30 16:18:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro125His' 3 unspecified role unspecified role bait bait tir sufficient to bind sufficient binding region sufficient to bind range range range range P58753:p.Pro125His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P H Wed May 02 16:01:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro125his' Tue Jun 30 20:17:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro125His' physical association physical association 2A-2 No interaction was observed when using the Mal-bait combined with a MalTIR-prey only containing the C-terminal TIR region. tirap-myd88-4 2 6 unspecified role unspecified role bait bait tir sufficient to bind sufficient binding region sufficient to bind range range range range Q99836:p.Pro200His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P H Wed May 02 16:41:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro200his' Tue Jun 30 17:03:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro200His' 3 unspecified role unspecified role prey prey P58753:p.Pro125His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P H Wed May 02 20:07:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro125his' Tue Jun 30 17:46:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro125His' tir sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association 2B-2 myd88-tirap-4 2 6 unspecified role unspecified role bait bait tir sufficient to bind sufficient binding region sufficient to bind range range range range Q99836:p.Pro200His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain P H Wed May 02 18:24:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro200his' Tue Jun 30 18:20:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro200His' 6 unspecified role unspecified role prey prey tir sufficient to bind sufficient binding region sufficient to bind range range range range Q99836:p.Pro200His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain P H Wed May 02 14:40:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro200his' Tue Jun 30 17:45:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro200His' physical association physical association 2B-1 binding of the MyD88TIR-prey was completely lost when using MyD88P200H as a bait. se54ysr5xy-1 2 3 unspecified role unspecified role prey prey tir sufficient to bind sufficient binding region sufficient to bind range range range range 7 unspecified role unspecified role bait bait icd sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association 3A, Table 2 tlr4-ticam2-1 2 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait icd sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association 3Ai Fig 3B - not entered as I dont see how you can distinguish here between effect of MAL alone or with MyD88. Nor same situation in fig 3D - with MAL and MyD88 with TLR2. tlr4-ticam2-2 1 3 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait leptin_receptor tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined icd sufficient to bind sufficient binding region sufficient to bind range range range range association association 3C The MyD88-prey protein was only precipitated in the presence of Mal/Tirap. tlr4-myd88-2 1 3 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait leptin_receptor tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined icd sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3Ci tlr4-tirap-1 2 3 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait icd sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association 3D tlr4-ticam2-3 2 4 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Table 2 Fig 3B - not entered as I dont see how you can distinguish here between effect of MAL alone or with MyD88. Nor same situation in fig 3D - with MAL and MyD88 with TLR2. myd88-myd88-13 2 5 unspecified role unspecified role bait bait tir sufficient to bind sufficient binding region sufficient to bind range range range range 6 unspecified role unspecified role prey prey physical association physical association Table 2 sarm1-myd88-1 2 5 unspecified role unspecified role bait bait tir sufficient to bind sufficient binding region sufficient to bind range range range range 4 unspecified role unspecified role prey prey physical association physical association Table 2i