IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method The zinc finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast. The zinc finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast. The Journal of biological chemistry 2006 imex curation Heurgué-Hamard V., Graille M., Scrima N., Ulryck N., Champ S., van Tilbeurgh H., Buckingham RH. herman.van-tilbeurgh@ibbmc.u-psud.fr, richard.buckingham@ibpc.fr 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) pull down pull down western blot western blot Immuno blot Immuno blot Heurgué-Hamard V., Graille M., Scrima N., Ulryck N., Champ S., van Tilbeurgh H., Buckingham RH. herman.van-tilbeurgh@ibbmc.u-psud.fr, richard.buckingham@ibpc.fr Accepted 2017-AUG-01 AT 10:50 BST AT 10:50 BST by MGT The Journal of biological chemistry 2006 Only protein-protein interactions imex curation imex curation The zinc finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast. The zinc finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast. The Journal of biological chemistry 2006 imex curation Heurgué-Hamard V., Graille M., Scrima N., Ulryck N., Champ S., van Tilbeurgh H., Buckingham RH. herman.van-tilbeurgh@ibbmc.u-psud.fr, richard.buckingham@ibpc.fr 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as predetermined predetermined participant predetermined Heurgué-Hamard V., Graille M., Scrima N., Ulryck N., Champ S., van Tilbeurgh H., Buckingham RH. herman.van-tilbeurgh@ibbmc.u-psud.fr, richard.buckingham@ibpc.fr Accepted 2017-AUG-01 AT 10:50 BST AT 10:50 BST by MGT The Journal of biological chemistry 2006 Only protein-protein interactions imex curation imex curation erf1_yeast Eukaryotic peptide chain release factor subunit 1 SUP45 SAL4 SUP1 YBR143C YBR1120 Omnipotent suppressor protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDNEVEKNIEIWKVKKLVQSLEKARGNGTSMISLVIPPKGQIPLYQKMLTDEYGTASNIKSRVNRLSVLSAITSTQQKLKLYNTLPKNGLVLYCGDIITEDGKEKKVTFDIEPYKPINTSLYLCDNKFHTEVLSELLQADDKFGFIVMDGQGTLFGSVSGNTRTVLHKFTVDLPKKHGRGGQSALRFARLREEKRHNYVRKVAEVAVQNFITNDKVNVKGLILAGSADFKTDLAKSELFDPRLACKVISIVDVSYGGENGFNQAIELSAEALANVKYVQEKKLLEAYFDEISQDTGKFCYGIDDTLKALDLGAVEKLIVFENLETIRYTFKDAEDNEVIKFAEPEAKDKSFAIDKATGQEMDVVSEEPLIEWLAANYKNFGATLEFITDKSSEGAQFVTGFGGIGAMLRYKVNFEQLVDESEDEYYDEDEGSDYDFI 9B59133EE3B1F61E 9B59133EE3B1F61E mtq2_yeast eRF1 methyltransferase catalytic subunit MTQ2 MTQ2 MTC6 N(5)-glutamine methyltransferase MTQ2 YDR140W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLPTPYVKCDYDKVYEPAEDSFLILDCLEKEHDFLKQKFGNRLAIVCEIGSGSGIVTTFLMQNKIIPQENSIHLAVDINPWALEATLDTAKLNSCKSSFLEVIQADLNSSIRNNQVDVLIFNPPYVPAECVPDVPGSREEADQWLDLALLGGKDGMAITDKLLRQLEQILSPDGVAYILFCARNKPKEVIKRFVDTYKWNVKLIETRKAGWEVLSVYSFTR C3CF6BF6A05E862D tr112_yeast Multifunctional methyltransferase subunit TRM112 YNR046W N3445 TRM112 tRNA methyltransferase 112 eRF1 methyltransferase subunit TRM112 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHLV 3CFB2ABDDFB0E38A erf3_yeast Eukaryotic peptide chain release factor GTP-binding subunit SUP35 GST1 PNM2 SAL3 SUF12 SUP2 YDR172W YD9395.05 ERF2 ERF-3 Translation release factor 3 Polypeptide release factor 3 Omnipotent suppressor protein 2 G1 to S phase transition protein 1 PSI no more protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDSNQGNNQQNYQQYSQNGNQQQGNNRYQGYQAYNAQAQPAGGYYQNYQGYSGYQQGGYQQYNPDAGYQQQYNPQGGYQQYNPQGGYQQQFNPQGGRGNYKNFNYNNNLQGYQAGFQPQSQGMSLNDFQKQQKQAAPKPKKTLKLVSSSGIKLANATKKVGTKPAESDKKEEEKSAETKEPTKEPTKVEEPVKKEEKPVQTEEKTEEKSELPKVEDLKISESTHNTNNANVTSADALIKEQEEEVDDEVVNDMFGGKDHVSLIFMGHVDAGKSTMGGNLLYLTGSVDKRTIEKYEREAKDAGRQGWYLSWVMDTNKEERNDGKTIEVGKAYFETEKRRYTILDAPGHKMYVSEMIGGASQADVGVLVISARKGEYETGFERGGQTREHALLAKTQGVNKMVVVVNKMDDPTVNWSKERYDQCVSNVSNFLRAIGYNIKTDVVFMPVSGYSGANLKDHVDPKECPWYTGPTLLEYLDTMNHVDRHINAPFMLPIAAKMKDLGTIVEGKIESGHIKKGQSTLLMPNKTAVEIQNIYNETENEVDMAMCGEQVKLRIKGVEEEDISPGFVLTSPKNPIKSVTKFVAQIAIVELKSIIAAGFSCVMHVHTAIEEVHIVKLLHKLEKGTNRKSKKPPAFAKKGMKVIAVLETEAPVCVETYQDYPQLGRFTLRDQGTTIAIGKIVKIAE 43912A6D77DFA153 43912A6D77DFA153 mtq2-trm112-1 2 5 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role prey prey physical association physical association Fig. 3 mtq2_trm112-sup45-1 3 7 ancillary ancillary neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 4 enzyme target enzyme target substrate substrate neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeast Saccharomyces cerevisiae Baker's yeast 19 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Figs. 4, 5 Enzyme complex was active rrespective of whether the 2 components were co-expressed or reconstituted in vitro. GTP was also required in the assay mix. mtq2-trm112 S-adenosylmethionine-dependent eRF1 methyltransferase complex MTQ2-TRM112 eRF1 methyltransferase complex MTQ2:TRM112 S-adenosylmethionine-dependent methyltransferase complex S-adenosyl-L-methionine-dependent methyltransferase complex SAM-dependent methyltransferase complex 6 unspecified role unspecified role mtq2 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 enzyme enzyme trm112 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 23 direct interaction direct interaction yeast Saccharomyces cerevisiae Baker's yeast stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction S-adenosylmethionine-dependent methyltransferase responsible for methylating Gln-182 present in the conserved GGQ motif of the eRF1 subunit of the class 1 peptide chain release factor eRF1-eRF3 complex. Methylation occurs in the presence of GTP. This terminates the translation of nascent peptides in response to the termination codons UAA, UAG and UGA. Uses S-adenosyl L-methionine as methyl donor. Heterodimer MW = 40.8 kDa Accepted 2016-JUN-08 by BMELDAL