UniProt UniProt http://www.uniprot.org G1/S Cyclins interact with regulatory subunit of PKA via A-kinase anchoring protein, AKAP95. G1/S Cyclins interact with regulatory subunit of PKA via A-kinase anchoring protein, AKAP95. Cell cycle (Georgetown, Tex.) 2006 imex curation Arsenijevic T., Degraef C., Dumont JE., Roger PP., Pirson I. tarsenij@ulb.ac.be 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Arsenijevic T., Degraef C., Dumont JE., Roger PP., Pirson I. tarsenij@ulb.ac.be Accepted 2016-APR-21 AT 11:16 BST AT 11:16 BST by MGT Cell cycle (Georgetown, Tex.) 2006 Only protein-protein interactions imex curation imex curation G1/S Cyclins interact with regulatory subunit of PKA via A-kinase anchoring protein, AKAP95. G1/S Cyclins interact with regulatory subunit of PKA via A-kinase anchoring protein, AKAP95. Cell cycle (Georgetown, Tex.) 2006 imex curation Arsenijevic T., Degraef C., Dumont JE., Roger PP., Pirson I. tarsenij@ulb.ac.be 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Arsenijevic T., Degraef C., Dumont JE., Roger PP., Pirson I. tarsenij@ulb.ac.be Accepted 2016-APR-21 AT 11:16 BST AT 11:16 BST by MGT Cell cycle (Georgetown, Tex.) 2006 Only protein-protein interactions imex curation imex curation G1/S Cyclins interact with regulatory subunit of PKA via A-kinase anchoring protein, AKAP95. G1/S Cyclins interact with regulatory subunit of PKA via A-kinase anchoring protein, AKAP95. Cell cycle (Georgetown, Tex.) 2006 imex curation Arsenijevic T., Degraef C., Dumont JE., Roger PP., Pirson I. tarsenij@ulb.ac.be 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Arsenijevic T., Degraef C., Dumont JE., Roger PP., Pirson I. tarsenij@ulb.ac.be Accepted 2016-APR-21 AT 11:16 BST AT 11:16 BST by MGT Cell cycle (Georgetown, Tex.) 2006 Only protein-protein interactions imex curation imex curation kap2_human cAMP-dependent protein kinase type II-alpha regulatory subunit PKR2 PRKAR2 PRKAR2A protein protein human Homo sapiens Human MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ DIP protein P13861 original sequence version: 107 DIP protein P13861 original sequence version: 128 C7D6E8E476E1DB65 ccnd3_human G1/S-specific cyclin-D3 CCND3 protein protein human Homo sapiens Human MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL DIP protein P30281 original sequence version: 150 DIP protein P30281 original sequence version: 111 16E7B1604FEB0029 ccne1_human G1/S-specific cyclin-E1 CCNE1 CCNE protein protein human Homo sapiens Human MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQPWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA DIP protein P24864 original sequence version: 114 DIP protein P24864 original sequence version: 150 424DF0B253B7047E akap8_canlf A-kinase anchor protein 8 AKAP8 AKAP95 A-kinase anchor protein 95 kDa protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MEQGYGGYGAWSAGPTNTQGAYGTGVASWQGYENYNYYGAQNTSVTTGASYSYGPASWETTKASDSLGAGGPAVHMASYGPEPCTDNSDSLIAKINQRLDMMSKEGGRGGSSGGGEGMQDRESSFRFQSYESYDSRSCLPEHHPYRPSYSYDYDFDPMPDRNGGFSSQYGDCRDPARERGSLDGFMRGRGQGQGQGRFQDRSNPSTFMRSDPFMPPSASSEPLSAPWPELNYVGGRGLGGPSPSRPPPSLFSQSMAPDFGVMGMQGAGGYDNSVPYGCGRSQTRMRDRPRRRGFDRCGPDGMGRKRKQLQIYDEPDAKLARADSEGDFSENDDGAADFRSGDEEFRGEDEFFDPGRQRGEKDDEDDEVKKRREKQRRRDRMRDRAADRIQFACSVCKFRSFEDEEIQKHLQSKFHKETLRFISTKLPDKTVEFLQEYIVNRNKKIEKRRQELMEKESTKPKPDPFKGIGQEHFFKKIEAAHCLACDMLIPAQHQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVARSVLNNRHIVKMLEKYLKGEDPFTSEAVDPEIEGDDTLGGEKEETPEEVAAEVLAEVITAAVRAVDGEGAPAPEGSDTPPEGQGPVDTAEATHSPHSEQLVEVETPCGAAPEKGDANAEAGGETTEAAGEEQEVVAKTDGAVDGTVRGAAPAPPVTETKAEQTEAEPKDVTPTE B714D7E7E1731382 akap8-ccne1-1 3 6 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1 and 2B CDK2 (co-transfected CDK2 Uniprot P24941) akap8-ccnd3-3 3 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2A CDK4 (co-transfected HA-CDK4 Uniprot P11802) prkar2a-ccnd3-1 2 7 stimulator stimulator ancillary ancillary nucl transfection nucleic acid transfection nucl transfection region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A ccne1-prkar2a-1 1 4 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 stimulator stimulator ancillary ancillary nucl transfection nucleic acid transfection nucl transfection region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3B CDK2 (co-transfected CDK2 Uniprot P24941) ccnd3-akap8-4 3 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4 Association is independent of cAMP TSH stimulation (TSH receptor cotransfected)