HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Lipopolysaccharide binding protein binds to triacylated and diacylated lipopeptides and mediates innate immune responses. Lipopolysaccharide binding protein binds to triacylated and diacylated lipopeptides and mediates innate immune responses. Journal of immunology (Baltimore, Md. : 1950) 2004 imex curation Schröder NW., Heine H., Alexander C., Manukyan M., Eckert J., Hamann L., Göbel UB., Schumann RR. Interactions with Salmonella minnesota in figure 5B is not added since the specific LPS could no traced ralf.schumann@charite.de Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Schröder NW., Heine H., Alexander C., Manukyan M., Eckert J., Hamann L., Göbel UB., Schumann RR. Interactions with Salmonella minnesota in figure 5B is not added since the specific LPS could no traced ralf.schumann@charite.de Accepted 2017-FEB-22 AT 11:20 GMT AT 11:20 GMT by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2004 imex curation Lipopolysaccharide binding protein binds to triacylated and diacylated lipopeptides and mediates innate immune responses. Lipopolysaccharide binding protein binds to triacylated and diacylated lipopeptides and mediates innate immune responses. Journal of immunology (Baltimore, Md. : 1950) 2004 imex curation Schröder NW., Heine H., Alexander C., Manukyan M., Eckert J., Hamann L., Göbel UB., Schumann RR. Interactions with Salmonella minnesota in figure 5B is not added since the specific LPS could no traced ralf.schumann@charite.de Only protein-protein interactions imex curation in vitro In vitro electrophoresis electrophoretic mobility-based method electrophoresis weight silver stain molecular weight estimation by silver staining weight silver stain Schröder NW., Heine H., Alexander C., Manukyan M., Eckert J., Hamann L., Göbel UB., Schumann RR. Interactions with Salmonella minnesota in figure 5B is not added since the specific LPS could no traced ralf.schumann@charite.de Accepted 2017-FEB-22 AT 11:20 GMT AT 11:20 GMT by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2004 imex curation cd14_human Monocyte differentiation antigen CD14 CD14 Myeloid cell-specific leucine-rich glycoprotein protein protein human Homo sapiens Human MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA DIP protein P08571 original sequence version: 96 DIP protein P08571 original sequence version: null 1746CDB41F394F8D pam3csk4 Pam3CSK4 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q9r3n6_mycfe malP malp protein protein Mycoplasma fermentans Mycoplasma fermentans MKKSKKILLGLSPIAAVLPAVAVSCGNNDESNISFKEKDISKYTTTNANGKQVVKNAELLKLKPVLITDEGKIDDKSFNQSAFEALKAINKQTGIEINSVEPSSNFESAYNSALSAGHKIWVLNGFKHQQSIKQYIDAHREELERNQIKIIGIDFDIETEYKWFYSLQFNIKESAFTTGYAIASWLSEQDESKRVVASFGVGAFPGVTTFNEGFAKGILYYNQKHKSSKIYHTSPVKLDSGFTAGEKMNTVINNVLSSTPADVKYNPHVILSVAGPATFETVRLANKGQYVIGVDSDQGMIQDKDRILTSVLKHIKQAVYETLLDLILEKEEGYKPYVVKDKKADKKWSHFGTQKEKWIGVAENHFSNTEEQAKINNKIKEAIKMFKELPEDFVKYINSDKALKDGNKIDNVSERLEAIISAINKAAK 59808324E218F03C lbp_human Lipopolysaccharide-binding protein LBP protein protein human Homo sapiens Human MGALARALPSILLALLLTSTPEALGANPGLVARITDKGLQYAAQEGLLALQSELLRITLPDFTGDLRIPHVGRGRYEFHSLNIHSCELLHSALRPVPGQGLSLSISDSSIRVQGRWKVRKSFFKLQGSFDVSVKGISISVNLLLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKVLESRICEMIQKSVSSDLQPYLQTLPVTTEIDSFADIDYSLVEAPRATAQMLEVMFKGEIFHRNHRSPVTLLAAVMSLPEEHNKMVYFAISDYVFNTASLVYHEEGYLNFSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPLPLLKRVQLYDLGLQIHKDFLFLGANVQYMRV 5A0E4B9E5E604C72 s-[2,3-bis(palmitoyloxy)propyl]-cys-ser-lys-lys-lys-lys S-[ 2,3- bis( palmitoyloxy)-( 2RS)- propyl]-[ R]-cysteinyl-[S]-seryl-[S]-lysyl-[S]-lysyl-[S]-lysyl-[S]-lysine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) lp2-cd14-1 2 7 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component direct interaction direct interaction 2C-D lp2-lbp-1 1 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 5A lbp-lp3-1 1 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 5A lbp-1 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 5A