IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Thyrostimulin, a heterodimer of two new human glycoprotein hormone subunits, activates the thyroid-stimulating hormone receptor. Thyrostimulin, a heterodimer of two new human glycoprotein hormone subunits, activates the thyroid-stimulating hormone receptor. The Journal of clinical investigation 2002 imex curation Nakabayashi K., Matsumi H., Bhalla A., Bae J., Mosselman S., Hsu SY., Hsueh AJ. The Introduction to this publication states:- "The GenBank accession numbers for A2 and B5 are AF403384 and AF403430,.. " However for the A2 protein - acc. no AF403384 - both NCBI and UniProt databases relate this entry to the Gene RXFP2- Relaxin receptor 2. The protein sequence of A2 as given in figure 1 bears no relationship to the sequence given in UniProt entry Q8WXD0 - for Relaxin receptor 2. The sequence in fig 1 however does relate to UniProt entry Q96T91 -for Gene GPHA2 -Glycoprotein hormone alpha-2, and this ID has been used here for the A2 protein. Dark Space Dataset =no6? aaron.hsueh@stanford.edu 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Nakabayashi K., Matsumi H., Bhalla A., Bae J., Mosselman S., Hsu SY., Hsueh AJ. The Introduction to this publication states:- "The GenBank accession numbers for A2 and B5 are AF403384 and AF403430,.. " However for the A2 protein - acc. no AF403384 - both NCBI and UniProt databases relate this entry to the Gene RXFP2- Relaxin receptor 2. The protein sequence of A2 as given in figure 1 bears no relationship to the sequence given in UniProt entry Q8WXD0 - for Relaxin receptor 2. The sequence in fig 1 however does relate to UniProt entry Q96T91 -for Gene GPHA2 -Glycoprotein hormone alpha-2, and this ID has been used here for the A2 protein. Dark Space Dataset =no6? Cross linking agent:DSS (disuccinimidyl suberate) aaron.hsueh@stanford.edu Accepted 2017-AUG-08 AT 14:57 BST AT 14:57 BST by PPORRAS The Journal of clinical investigation 2002 Only protein-protein interactions imex curation imex curation Thyrostimulin, a heterodimer of two new human glycoprotein hormone subunits, activates the thyroid-stimulating hormone receptor. Thyrostimulin, a heterodimer of two new human glycoprotein hormone subunits, activates the thyroid-stimulating hormone receptor. The Journal of clinical investigation 2002 imex curation Nakabayashi K., Matsumi H., Bhalla A., Bae J., Mosselman S., Hsu SY., Hsueh AJ. The Introduction to this publication states:- "The GenBank accession numbers for A2 and B5 are AF403384 and AF403430,.. " However for the A2 protein - acc. no AF403384 - both NCBI and UniProt databases relate this entry to the Gene RXFP2- Relaxin receptor 2. The protein sequence of A2 as given in figure 1 bears no relationship to the sequence given in UniProt entry Q8WXD0 - for Relaxin receptor 2. The sequence in fig 1 however does relate to UniProt entry Q96T91 -for Gene GPHA2 -Glycoprotein hormone alpha-2, and this ID has been used here for the A2 protein. Dark Space Dataset =no6? aaron.hsueh@stanford.edu 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Nakabayashi K., Matsumi H., Bhalla A., Bae J., Mosselman S., Hsu SY., Hsueh AJ. The Introduction to this publication states:- "The GenBank accession numbers for A2 and B5 are AF403384 and AF403430,.. " However for the A2 protein - acc. no AF403384 - both NCBI and UniProt databases relate this entry to the Gene RXFP2- Relaxin receptor 2. The protein sequence of A2 as given in figure 1 bears no relationship to the sequence given in UniProt entry Q8WXD0 - for Relaxin receptor 2. The sequence in fig 1 however does relate to UniProt entry Q96T91 -for Gene GPHA2 -Glycoprotein hormone alpha-2, and this ID has been used here for the A2 protein. Dark Space Dataset =no6? aaron.hsueh@stanford.edu Accepted 2017-AUG-08 AT 14:57 BST AT 14:57 BST by PPORRAS The Journal of clinical investigation 2002 Only protein-protein interactions imex curation imex curation Thyrostimulin, a heterodimer of two new human glycoprotein hormone subunits, activates the thyroid-stimulating hormone receptor. Thyrostimulin, a heterodimer of two new human glycoprotein hormone subunits, activates the thyroid-stimulating hormone receptor. The Journal of clinical investigation 2002 imex curation Nakabayashi K., Matsumi H., Bhalla A., Bae J., Mosselman S., Hsu SY., Hsueh AJ. The Introduction to this publication states:- "The GenBank accession numbers for A2 and B5 are AF403384 and AF403430,.. " However for the A2 protein - acc. no AF403384 - both NCBI and UniProt databases relate this entry to the Gene RXFP2- Relaxin receptor 2. The protein sequence of A2 as given in figure 1 bears no relationship to the sequence given in UniProt entry Q8WXD0 - for Relaxin receptor 2. The sequence in fig 1 however does relate to UniProt entry Q96T91 -for Gene GPHA2 -Glycoprotein hormone alpha-2, and this ID has been used here for the A2 protein. Dark Space Dataset =no6? aaron.hsueh@stanford.edu 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro deamidation deamidation assay amidase assay deamidation western blot western blot Immuno blot Immuno blot Nakabayashi K., Matsumi H., Bhalla A., Bae J., Mosselman S., Hsu SY., Hsueh AJ. The Introduction to this publication states:- "The GenBank accession numbers for A2 and B5 are AF403384 and AF403430,.. " However for the A2 protein - acc. no AF403384 - both NCBI and UniProt databases relate this entry to the Gene RXFP2- Relaxin receptor 2. The protein sequence of A2 as given in figure 1 bears no relationship to the sequence given in UniProt entry Q8WXD0 - for Relaxin receptor 2. The sequence in fig 1 however does relate to UniProt entry Q96T91 -for Gene GPHA2 -Glycoprotein hormone alpha-2, and this ID has been used here for the A2 protein. there is no MI term for "deamidation" - so have used the "reverse reaction" term - amidation. Dark Space Dataset =no6? The origin of the New England Biolabs PNGase F is stated to be from Flavobacterium meningosepticum. The UniProt entry for "PNGase F" -P21163- is the only entry for the Genus "Elizabethkingia"; which includes Chryseobacterium (Flavobacterium) meningosepticum and Chryseobacterium miricola. aaron.hsueh@stanford.edu Accepted 2017-AUG-08 AT 14:57 BST AT 14:57 BST by PPORRAS The Journal of clinical investigation 2002 Only protein-protein interactions imex curation imex curation Thyrostimulin, a heterodimer of two new human glycoprotein hormone subunits, activates the thyroid-stimulating hormone receptor. Thyrostimulin, a heterodimer of two new human glycoprotein hormone subunits, activates the thyroid-stimulating hormone receptor. The Journal of clinical investigation 2002 imex curation Nakabayashi K., Matsumi H., Bhalla A., Bae J., Mosselman S., Hsu SY., Hsueh AJ. The Introduction to this publication states:- "The GenBank accession numbers for A2 and B5 are AF403384 and AF403430,.. " However for the A2 protein - acc. no AF403384 - both NCBI and UniProt databases relate this entry to the Gene RXFP2- Relaxin receptor 2. The protein sequence of A2 as given in figure 1 bears no relationship to the sequence given in UniProt entry Q8WXD0 - for Relaxin receptor 2. The sequence in fig 1 however does relate to UniProt entry Q96T91 -for Gene GPHA2 -Glycoprotein hormone alpha-2, and this ID has been used here for the A2 protein. Dark Space Dataset =no6? aaron.hsueh@stanford.edu 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nakabayashi K., Matsumi H., Bhalla A., Bae J., Mosselman S., Hsu SY., Hsueh AJ. The Introduction to this publication states:- "The GenBank accession numbers for A2 and B5 are AF403384 and AF403430,.. " However for the A2 protein - acc. no AF403384 - both NCBI and UniProt databases relate this entry to the Gene RXFP2- Relaxin receptor 2. The protein sequence of A2 as given in figure 1 bears no relationship to the sequence given in UniProt entry Q8WXD0 - for Relaxin receptor 2. The sequence in fig 1 however does relate to UniProt entry Q96T91 -for Gene GPHA2 -Glycoprotein hormone alpha-2, and this ID has been used here for the A2 protein. Dark Space Dataset =no6? aaron.hsueh@stanford.edu Accepted 2017-AUG-08 AT 14:57 BST AT 14:57 BST by PPORRAS The Journal of clinical investigation 2002 Only protein-protein interactions imex curation imex curation cgb3_human Choriogonadotropin subunit beta 3 CGB5 CGB8 CGB3 CGB Choriogonadotropin subunit beta Chorionic gonadotropin chain beta protein protein human Homo sapiens Human MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ mint Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy 5598FB9E51A05748 fshb_human Follitropin subunit beta FSHB Follicle-stimulating hormone beta subunit Follitropin beta chain protein protein human Homo sapiens Human MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE DIP protein P01225 original sequence version: 142 9D2AF00DD76B8E2B lshb_human Lutropin subunit beta LHB Luteinizing hormone subunit beta protein protein human Homo sapiens Human MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL E411766253113F7C tshb_human Thyrotropin subunit beta TSHB Thyroid-stimulating hormone subunit beta Thyrotropin beta chain protein protein human Homo sapiens Human MTALFLMSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV 6A367538D8393DB7 gphb5_human Glycoprotein hormone beta-5 GPHB5 GPB5 ZLUT1 Thyrostimulin subunit beta protein protein human Homo sapiens Human MKLAFLFLGPMALLLLAGYGCVLGASSGNLRTFVGCAVREFTFLAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAHHRVCTYNETKQVTVKLPNCAPGVDPFYTYPVAIRCDCGACSTATTECETI 2C6C3BC0AA6725B9 pngf_elimr Peptide-N(4)-(N-acetyl-beta-D-glucosaminyl)asparagine amidase F ngl png Glycopeptide N-glycosidase N-glycanase protein protein elimr elimr Chryseobacterium miricola MRKLLIFSISAYLMAGIVSCKGVDSATPVTEDRLALNAVNAPADNTVNIKTFDKVKNAFGDGLSQSAEGTFTFPADVTTVKTIKMFIKNECPNKTCDEWDRYANVYVKNKTTGEWYEIGRFITPYWVGTEKLPRGLEIDVTDFKSLLSGNTELKIYTETWLAKGREYSVDFDIVYGTPDYKYSAVVPVIQYNKSSIDGVPYGKAHTLGLKKNIQLPTNTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNANTFQHQLGALGCSANPINNQSPGNWAPDRAGWCPGMAVPTRIDVLNNSLTGSTFSYEYKFQSWTNNGTNGDAFYAISSFVIAKSNTPISAPVVTN 22CF510F77C22539 gpha2_human Glycoprotein hormone alpha-2 GPHA2 GPA2 ZSIG51 Putative secreted protein Zsig51 Thyrostimulin subunit alpha protein protein human Homo sapiens Human MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY 6E924AF7BE8D7A70 gpha2-1 4 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 1B gphb5-gpha2-1 4 5 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 1B-2 cgb-gpha2-1 4 11 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 1B-3 cgb-gpha2-2 4 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 1B-4 weak interaction tshb-gpha2-1 4 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 1B-5 weak interaction 563a46-1 2 11 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component physical association physical association 3 A/B gphb5-ngl-2 3 9 enzyme target enzyme target substrate substrate neutral component neutral component region dnasn deamidated L-asparagine (2S)-2-aminobutanedioic acid 2-azanylbutanedioic acid L-aspartic acid MOD_RES Deamidated asparagine aminosuccinic acid dNAsn undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 10 enzyme enzyme neutral component neutral component deamidation deamidation reaction deamidation 3C gphb5-ngl-1 3 11 enzyme target enzyme target substrate substrate neutral component neutral component region dnasn deamidated L-asparagine (2S)-2-aminobutanedioic acid 2-azanylbutanedioic acid L-aspartic acid MOD_RES Deamidated asparagine aminosuccinic acid dNAsn undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 10 enzyme enzyme neutral component neutral component deamidation deamidation reaction deamidation 3C-2 264wtst-1 1 11 unspecified role unspecified role neutral component neutral component partially purified partially purified human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 9 unspecified role unspecified role neutral component neutral component partially purified partially purified human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 3C