IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Gar1p binds to the small nucleolar RNAs snR10 and snR30 in vitro through a nontypical RNA binding element. Gar1p binds to the small nucleolar RNAs snR10 and snR30 in vitro through a nontypical RNA binding element. The Journal of biological chemistry 1998 imex curation Bagni C., Lapeyre B. lapeyre@jones.igm.cnrs-mop.fr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom autoradiography autoradiography Bagni C., Lapeyre B. lapeyre@jones.igm.cnrs-mop.fr Accepted 2015-AUG-18 by ORCHARD The Journal of biological chemistry 1998 imex curation gar1_yeast H/ACA ribonucleoprotein complex subunit GAR1 YHR089C GAR1 snoRNP protein GAR1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFRGGNRGGRGGFRGGFRGGRTGSARSFQQGPPDTVLEMGAFLHPCEGDIVCRSINTKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTIKCGDGVQATSFKEGDKFYIAADKLLPIERFLPKPKVVGPPKPKNKKKRSGAPGGRGGASMGRGGSRGGFRGGRGGSSFRGGRGGSSFRGGSRGGSFRGGSRGGSRGGFRGGRR C197FE85644DD0F8 C197FE85644DD0F8 snr30_yeast_rna small nuclear RNA 30 Yeast snorna small nucleolar rna snoRNA snorna yeast Saccharomyces cerevisiae Baker's yeast AACCAUAGUCUCGUGCUAGUUCGGUACUAUACAGGGAAGGGAAGUCACUCGCAUACGUGUGUGUGCAUUUCUUGCUAUUGCUGCUUAGCUUCUCUAAAACACUGGGCUAGCGUUUUUCAACGCUCGAGAGGCAGAGUCUCAAGGAGCCUCCAAUGGGCCUCACGUAUUCAUCUAGAUGGCGCUUCGGACAACGGCAUCACAUAAGAGAUGCAGCUCCUGACUUCUCCUCUGAUCUUCGUGAUCAGAGUUUUGAGUCGUCAGACUACGAGCAGUUUCUCUUAGUCGUUGCAUCGGGUGCUGUUGCCUUAACGAUGUGUAUAUGGGGUUCGGGGGCUGUUGCCAUGAUAUAUAUGGAUGAGACAGAAGUGGCCCCGUUGACGAGUUUAACUUAGAUUAAGUAGGACGCAUGAUCUUGAGCUCUUUUCCUAUACUUUGUCCUAUGGCCAGCUUUCUCCUUAUUACGAAGAGAUUGCGGGAUGUGGGUGCAGAGUGGGAAAAUCUGAGUUCGGUCAUCUUUGUUGUUCGUCCUACCGCAGUAUAUUCCUAAACACUAUGAAAUGACCCUAGUUGGUCCAUGAUCAUUUGGGUAAAACCAUACUGCAGACA snr10_yeast_rna small nucleolar RNA 10 Yeast snorna small nucleolar rna snoRNA snorna yeast Saccharomyces cerevisiae Baker's yeast AACGCAAAUUUAACAGCCAUUCGUAACACGUACAGUAUCUCGUCGAGGUUGAACCCCUCCGGGGCGUUCUUGACCCAUGAAGAAUGUGGAUUGGUGUUGCAAUAUAUUUAUUAUUGGCUUGGACUGGAGAACAAAUUUAUCGAUCUUGGGUGCAACAGUCUUUCUGUCGUCUGUUUUUUAGCAGAUCUAAGGGUUUACCUUCGUGUGCCCGGAUGAGGACCGUUGCAAGGAUUGAUAAUACAACU gar1p_snr10-1 1 2 unspecified role unspecified role prey prey label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 4 unspecified role unspecified role bait bait tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig1,Fig2, Fig4 gar1p_snr30-1 1 3 unspecified role unspecified role bait bait tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 2 unspecified role unspecified role prey prey label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association Fig1, Fig2, Fig4 the reaction was performed at various concentration of KCl and it occurs in the presence of 10 to 100 mM KCl snr10 yeast_1-gar1-30 1 3 competitor competitor competitor neutral component neutral component in vitro In vitro An excess 20X of snr30 abolishes the interaction 2 unspecified role unspecified role prey prey label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role bait bait tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro association association Fig3 snr30_yeast_rna-gar1-10 1 4 competitor competitor competitor neutral component neutral component in vitro In vitro an excess of 20x of snr10 abolishes the binding 2 unspecified role unspecified role prey prey label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 3 unspecified role unspecified role bait bait tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro association association Fig3 the reaction was performed at various concentration of KCl and it occurs in the presence of 10 to 100 mM KCl