IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interactions within the yeast Sm core complex: from proteins to amino acids. Interactions within the yeast Sm core complex: from proteins to amino acids. Molecular and cellular biology 1998 imex curation Camasses A., Bragado-Nilsson E., Martin R., Séraphin B., Bordonné R., Camasses A., Bragado-Nilsson E., Martin R., Séraphin B., Bordonné R. bordonne@ibmc.u-strasbg.fr 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Camasses A., Bragado-Nilsson E., Martin R., Séraphin B., Bordonné R., Camasses A., Bragado-Nilsson E., Martin R., Séraphin B., Bordonné R. A weak interaction between SME1 and LSM3 was observed but subsequently shown to be non-specific. bordonne@ibmc.u-strasbg.fr Accepted 2017-MAY-10 AT 13:03 BST AT 13:03 BST by PPORRAS Molecular and cellular biology 1998 imex curation All added. Interactions within the yeast Sm core complex: from proteins to amino acids. Interactions within the yeast Sm core complex: from proteins to amino acids. Molecular and cellular biology 1998 imex curation Camasses A., Bragado-Nilsson E., Martin R., Séraphin B., Bordonné R., Camasses A., Bragado-Nilsson E., Martin R., Séraphin B., Bordonné R. bordonne@ibmc.u-strasbg.fr 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Camasses A., Bragado-Nilsson E., Martin R., Séraphin B., Bordonné R., Camasses A., Bragado-Nilsson E., Martin R., Séraphin B., Bordonné R. A weak interaction between SME1 and LSM3/SmX4 was observed but subsequently shown to be non-specific. bordonne@ibmc.u-strasbg.fr Accepted 2017-MAY-10 AT 13:03 BST AT 13:03 BST by PPORRAS Molecular and cellular biology 1998 imex curation All added. Interactions within the yeast Sm core complex: from proteins to amino acids. Interactions within the yeast Sm core complex: from proteins to amino acids. Molecular and cellular biology 1998 imex curation Camasses A., Bragado-Nilsson E., Martin R., Séraphin B., Bordonné R., Camasses A., Bragado-Nilsson E., Martin R., Séraphin B., Bordonné R. bordonne@ibmc.u-strasbg.fr 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Camasses A., Bragado-Nilsson E., Martin R., Séraphin B., Bordonné R., Camasses A., Bragado-Nilsson E., Martin R., Séraphin B., Bordonné R. bordonne@ibmc.u-strasbg.fr Accepted 2017-MAY-10 AT 13:03 BST AT 13:03 BST by PPORRAS Molecular and cellular biology 1998 imex curation All added. smd3_yeast Small nuclear ribonucleoprotein Sm D3 SMD3 YLR147C L9634.6 snRNP core protein D3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTMNGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFKKNSSRPMPPIRGPKRR BB02A56C5AD70CF2 BB02A56C5AD70CF2 ruxe_yeast Small nuclear ribonucleoprotein E SME1 YOR159C Sm protein E protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNKVKTKAMVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSADGKEDVEKGTPLGKILLKGDNITLITSAD B76D72DA8456F3B5 B76D72DA8456F3B5 snf1_yeast Carbon catabolite-derepressing protein kinase SNF1 CAT1 CCR1 GLC2 PAS14 Sucrose nonfermentating protein 1 D8035.20 YDR477W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSNNNTNTAPANANSSHHHHHHHHHHHHHGHGGSNSTLNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFKVDLPEYLLPPDLKPHPEEENENNDSKKDGSSPDNDEIDDNLVNILSSTMGYEKDEIYESLESSEDTPAFNEIRDAYMLIKENKSLIKDMKANKSVSDELDTFLSQSPPTFQQQSKSHQKSQVDHETAKQHARRMASAITQQRTYHQSPFMDQYKEEDSTVSILPTSLPQIHRANMLAQGSPAASKISPLVTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSEEDLWTIKLRWKYDIGNKTNTNEKIPDLMKMVIQLFQIETNNYLVDFKFDGWESSYGDDTTVSNISEDEMSTFSAYPFLHLTTKLIMELAVNSQSN F5C63565C986C4E3 F5C63565C986C4E3 ruxg_yeast Small nuclear ribonucleoprotein G SNP2 YFL017Bw YFL017W-A SMX2 Sm protein G protein protein yeast Saccharomyces cerevisiae Baker's yeast MVSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINGEDPANNHQLGLQTVIRGNSIISLEALDAI 5C6208B8C5A9AB33 5C6208B8C5A9AB33 rsmb_yeast Small nuclear ribonucleoprotein-associated protein B SMB1 Sm protein B YER029C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKIQVAHSSRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEERVPKTQLDKLRPRKDSKDGTTLNIKVEKRVLGLTILRGEQILSTVVEDKPLLSKKERLVRDKKEKKQAQKQTKLRKEKEKKPGKIAKPNTANAKHTSSNSREIAQPSSSRYNGGNDNIGANRSRFNNEAPPQTRKFQPPPGFKRK 0A1078D5AA241430 0A1078D5AA241430 aakg_yeast 5'-AMP-activated protein kinase subunit gamma SNF4 CAT3 Regulatory protein CAT3 SCI1 Sucrose non-fermenting protein 4 YGL115W protein protein yeast Saccharomyces cerevisiae Baker's yeast MKPTQDSQEKVSIEQQLAVESIRKFLNSKTSYDVLPVSYRLIVLDTSLLVKKSLNVLLQNSIVSAPLWDSKTSRFAGLLTTTDFINVIQYYFSNPDKFELVDKLQLDGLKDIERALGVDQLDTASIHPSRPLFEACLKMLESRSGRIPLIDQDEETHREIVVSVLTQYRILKFVALNCRETHFLKIPIGDLNIITQDNMKSCQMTTPVIDVIQMLTQGRVSSVPIIDENGYLINVYEAYDVLGLIKGGIYNDLSLSVGEALMRRSDDFEGVYTCTKNDKLSTIMDNIRKARVHRFFVVDDVGRLVGVLTLSDILKYILLGSN 51B387E346EE9561 51B387E346EE9561 ruxf_yeast Small nuclear ribonucleoprotein F SMX3 YPR182W P9705.4 Sm protein F protein protein yeast Saccharomyces cerevisiae Baker's yeast MSESSDISAMQPVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN 1640D3237597B2D8 1640D3237597B2D8 sme1-smf1-1 2 5 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Text sme1-smx2-1 2 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Text sme1-smf1-2 3 5 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Table 1, Table 2 smf1-sme1-1 3 5 unspecified role unspecified role prey prey Q12330:p.Gln22Leu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 18:05:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln22leu' Tue Jun 30 17:15:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln22Leu' Q12330:p.Asp47His mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D H Fri Jul 22 10:55:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ile47his' Wed May 02 16:57:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp47his' Tue Jun 30 16:36:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp47His' Q12330:p.Leu81Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L P Wed May 02 15:54:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu81pro' Tue Jun 30 19:41:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu81Pro' Q12330:p.Val27Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V E Wed May 02 18:00:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val27glu' Tue Jun 30 20:07:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val27Glu' Q12330:p.Ile29Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I K Wed May 02 19:22:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile29lys' Tue Jun 30 17:41:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile29Lys' Q12330:p.Gly41Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G D Wed May 02 19:06:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly41asp' Tue Jun 30 18:35:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly41Asp' Q12330:p.Ile54Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I N Wed May 02 16:51:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile54asn' Tue Jun 30 20:18:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile54Asn' Q12330:p.Asp47Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D A Wed May 02 17:39:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp47ala' Tue Jun 30 17:45:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp47Ala' Q12330:p.Ile90Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I R Wed May 02 15:56:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile90arg' Tue Jun 30 17:06:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile90Arg' Q12330:p.Met50Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain M A Wed May 02 16:28:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met50ala' Tue Jun 30 17:30:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met50Ala' Q12330:p.Asn51Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain N A Wed May 02 16:22:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn51ala' Tue Jun 30 18:29:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn51Ala' Q12330:p.Ile80Phe mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I F Wed May 02 18:40:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile80phe' Tue Jun 30 17:42:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile80Phe' Q12330:p.Gly84Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G A Wed May 02 16:24:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly84ala' Tue Jun 30 20:02:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly84Ala' Q12330:p.Asn3Thr mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain N T Wed May 02 14:57:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn3thr' Tue Jun 30 17:47:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn3Thr' Q12330:p.Lys6Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K E Wed May 02 17:39:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys6glu' Tue Jun 30 16:02:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys6Glu' Q12330:p.Met10Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain M V Wed May 02 15:03:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met10val' Tue Jun 30 18:11:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met10Val' Q12330:p.Leu31Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L S Wed May 02 19:52:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu31ser' Tue Jun 30 16:48:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu31Ser' Q12330:p.Gly45Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G V Wed May 02 19:15:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly45val' Tue Jun 30 20:07:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly45Val' Q12330:p.[Glu59Ala;Asn63Asp] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain N D Wed May 02 16:40:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu59ala,asn63asp' Tue Jun 30 19:46:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu59Ala;Asn63Asp]' Q12330:p.Pro76Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain P S Wed May 02 16:22:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro76ser' Tue Jun 30 19:38:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro76Ser' Q12330:p.Gly84Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G A Wed May 02 15:29:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly84ala' Tue Jun 30 18:13:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly84Ala' 10 unspecified role unspecified role bait bait physical association physical association Table 1, Table 2, Table 3 Stop mutations at trp-30, gly-45, leu-82 and leu-89 of SME1 prevented binding to SMF1 smx2-sme1-2 3 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Table 1, Table 2 snf1-snf4-18 3 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Table 1 smb1-smd3-1 3 4 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Table 2 smd3-smb1-1 3 4 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Table 2 sme1-smf1-3 1 5 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 1A, 1B sme1-smx2-3 1 5 unspecified role unspecified role bait bait Q12330:p.Gln22Leu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 18:05:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln22leu' Tue Jun 30 19:07:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln22Leu' n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 1A, 1B smb1-smd3-2 1 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 1A smx2-sme1-3 3 5 unspecified role unspecified role prey prey Q12330:p.Gly41Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G D Wed May 02 20:26:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly41asp' Tue Jun 30 17:59:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly41Asp' Q12330:p.Ile54Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I N Wed May 02 18:03:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile54asn' Tue Jun 30 19:03:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile54Asn' Q12330:p.Asp47Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain D A Wed May 02 17:48:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp47ala' Tue Jun 30 19:43:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp47Ala' Q12330:p.Ile90Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I R Wed May 02 19:34:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile90arg' Tue Jun 30 18:20:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile90Arg' Q12330:p.Met50Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain M A Wed May 02 18:04:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met50ala' Tue Jun 30 20:02:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met50Ala' Q12330:p.Gln22Leu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 20:12:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln22leu' Tue Jun 30 18:51:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln22Leu' Q12330:p.Asp47His mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain D H Fri Jul 22 11:04:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ile47his' Wed May 02 15:45:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp47his' Tue Jun 30 17:52:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp47His' Q12330:p.Val27Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V E Wed May 02 17:31:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val27glu' Tue Jun 30 17:08:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val27Glu' Q12330:p.Ile29Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I K Wed May 02 17:55:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile29lys' Tue Jun 30 18:08:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile29Lys' Q12330:p.Asn86Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain N A Wed May 02 19:09:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn86ala' Tue Jun 30 18:09:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn86Ala' Q12330:p.Leu81Pro mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L P Wed May 02 15:19:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu81pro' Tue Jun 30 17:43:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu81Pro' Q12330:p.Asn3Thr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain N T Wed May 02 14:58:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn3thr' Tue Jun 30 18:05:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn3Thr' Q12330:p.Lys6Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K E Wed May 02 20:23:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys6glu' Tue Jun 30 16:57:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys6Glu' Q12330:p.Met10Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain M V Wed May 02 19:24:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met10val' Tue Jun 30 19:54:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met10Val' Q12330:p.Leu31Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L S Wed May 02 18:54:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu31ser' Tue Jun 30 16:53:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu31Ser' Q12330:p.Gly45Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G V Wed May 02 15:54:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly45val' Tue Jun 30 16:29:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly45Val' Q12330:p.Asn51Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain N A Wed May 02 16:15:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn51ala' Tue Jun 30 20:17:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn51Ala' Q12330:p.[Glu59Ala;Asn63Asp] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain N D Wed May 02 17:36:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu59ala,asn63asp' Tue Jun 30 16:46:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu59Ala;Asn63Asp]' Q12330:p.Pro76Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain P S Wed May 02 18:38:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro76ser' Tue Jun 30 18:50:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro76Ser' Q12330:p.Ile80Phe mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I F Wed May 02 20:27:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile80phe' Tue Jun 30 18:25:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile80Phe' Q12330:p.Lys83Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K V Wed May 02 17:07:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys83val' Tue Jun 30 18:22:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys83Val' Q12330:p.Gly84Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G A Wed May 02 16:01:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly84ala' Tue Jun 30 19:37:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly84Ala' 7 unspecified role unspecified role bait bait physical association physical association Table 1, Table 2, Table 3 Stop mutations at trp-30, gly-45, leu-82 of SME1 prevented binding to SMX2