IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Surface PD-L1, E-cadherin, CD24, and VEGFR2 as markers of epithelial cancer stem cells associated with rapid tumorigenesis. Surface PD-L1, E-cadherin, CD24, and VEGFR2 as markers of epithelial cancer stem cells associated with rapid tumorigenesis. Scientific reports 2017 imex curation Jinesh GG., Manyam GC., Mmeje CO., Baggerly KA., Kamat AM. Files for this submission can be found in /sp/pro6/intact/local/data/curation-material/2015/jinesh-2015b GJGerald@mdanderson.org,akamat@mdanderson.org 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions human-urinary_bladder_carcinoma Human urinary bladder carcinoma Human urinary_bladder_carcinoma urinary bladder carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jinesh GG., Manyam GC., Mmeje CO., Baggerly KA., Kamat AM. Files for this submission can be found in /sp/pro6/intact/local/data/curation-material/2015/jinesh-2015b The interaction was found in flocculate (UCAFm) cells derived from ascitic liquid found in a human bladder cancer patient. GJGerald@mdanderson.org,akamat@mdanderson.org Accepted 2017-SEP-06 AT 08:06 BST AT 08:06 BST by MGT Scientific reports 2017 Only protein-protein interactions imex curation Surface PD-L1, E-cadherin, CD24, and VEGFR2 as markers of epithelial cancer stem cells associated with rapid tumorigenesis. Surface PD-L1, E-cadherin, CD24, and VEGFR2 as markers of epithelial cancer stem cells associated with rapid tumorigenesis. Scientific reports 2017 imex curation Jinesh GG., Manyam GC., Mmeje CO., Baggerly KA., Kamat AM. Files for this submission can be found in /sp/pro6/intact/local/data/curation-material/2015/jinesh-2015b GJGerald@mdanderson.org,akamat@mdanderson.org 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions human-urinary_bladder_carcinoma Human urinary bladder carcinoma Human urinary_bladder_carcinoma urinary bladder carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jinesh GG., Manyam GC., Mmeje CO., Baggerly KA., Kamat AM. Files for this submission can be found in /sp/pro6/intact/local/data/curation-material/2015/jinesh-2015b The interaction was found in pellet (UCAPm) cells derived from ascitic liquid found in a human bladder cancer patient. GJGerald@mdanderson.org,akamat@mdanderson.org Accepted 2017-SEP-06 AT 08:06 BST AT 08:06 BST by MGT Scientific reports 2017 Only protein-protein interactions imex curation Surface PD-L1, E-cadherin, CD24, and VEGFR2 as markers of epithelial cancer stem cells associated with rapid tumorigenesis. Surface PD-L1, E-cadherin, CD24, and VEGFR2 as markers of epithelial cancer stem cells associated with rapid tumorigenesis. Scientific reports 2017 imex curation Jinesh GG., Manyam GC., Mmeje CO., Baggerly KA., Kamat AM. Files for this submission can be found in /sp/pro6/intact/local/data/curation-material/2015/jinesh-2015b GJGerald@mdanderson.org,akamat@mdanderson.org 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions human-urinary_bladder_carcinoma Human urinary bladder carcinoma Human urinary_bladder_carcinoma urinary bladder carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jinesh GG., Manyam GC., Mmeje CO., Baggerly KA., Kamat AM. Files for this submission can be found in /sp/pro6/intact/local/data/curation-material/2015/jinesh-2015b The interaction was found in trypsin-resistant epithelial (UCAPe) cells derived from ascitic liquid found in a human bladder cancer patient. GJGerald@mdanderson.org,akamat@mdanderson.org Accepted 2017-SEP-06 AT 08:06 BST AT 08:06 BST by MGT Scientific reports 2017 Only protein-protein interactions imex curation cadh1_human Cadherin-1 Epithelial cadherin Uvomorulin CAM 120/80 CDH1 CDHE UVO protein protein human Homo sapiens Human MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDCTGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVGHHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDVNEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD DIP protein P12830 original sequence version: 191 DIP protein P12830 original sequence version: 185 DIP protein P12830 original sequence version: 108 DIP protein P12830 original sequence version: null DIP protein P12830 original sequence version: 134 DIP protein P12830 original sequence version: 147 DIP protein P12830 original sequence version: 174 DIP protein P12830 original sequence version: 189 DIP protein P12830 original sequence version: 156 DIP protein P12830 original sequence version: 201 DIP protein P12830 original sequence version: 117 E427118043A13C67 rbp1_human RalA-binding protein 1 Ral-interacting protein 1 76 kDa Ral-interacting protein Dinitrophenyl S-glutathione ATPase RALBP1 RLIP1 RLIP76 RLIP protein protein human Homo sapiens Human MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDVVSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQIDVPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELFGNVVLKQVMKPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVINILLAQENEILTEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQSRQQHGRSETEEYSSESESESEDEEELQIILEDLQRQNEELEIKNNHLNQAIHEEREAIIELRVQLRLLQMQRAKAEQQAQEDEEPEWRGGAVQPPRDGVLEPKAAKEQPKAGKEPAKPSPSRDRKETSI EC6F75329FD8D062 rala_human Ras-related protein Ral-A RAL RALA protein protein human Homo sapiens Human MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL 6974341EA18C1975 cdh1-ralbp1-1 3 RalA 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level E-cadherin 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level native native RalBP1 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level native native association association 6a, 6b, 6c Verapamil (CHEBI:9948) and dasatinib (CHEBI:49375) reduced RalA activation and decreased the interaction of the bait with both preys. VEGF-A (P15692) increased RalA activation and its interaction with the bait, but reduced the amount of E-cadherin interacting. ralbp1-cdh1-1 2 RalA 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level RalBP1 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level native native physical association physical association 6a verapamil and dasatinib ralbp1-rala-1 1 RalA 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level RalBP1 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level native native physical association physical association 6a verapamil and dasatinib