IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. Biochimica et biophysica acta 2016 imex curation Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es Accepted 2016-JUN-02 AT 16:05 BST AT 16:05 BST by MGT Biochimica et biophysica acta 2016 Only protein-protein interactions imex curation VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. Biochimica et biophysica acta 2016 imex curation Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es Accepted 2016-JUN-02 AT 16:05 BST AT 16:05 BST by MGT Biochimica et biophysica acta 2016 Only protein-protein interactions imex curation VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. Biochimica et biophysica acta 2016 imex curation Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es Accepted 2016-JUN-02 AT 16:05 BST AT 16:05 BST by MGT Biochimica et biophysica acta 2016 Only protein-protein interactions imex curation VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. Biochimica et biophysica acta 2016 imex curation Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es Accepted 2016-JUN-02 AT 16:05 BST AT 16:05 BST by MGT Biochimica et biophysica acta 2016 Only protein-protein interactions imex curation VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. Biochimica et biophysica acta 2016 imex curation Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-ht-144 Homo sapiens ht-144 Human fibroblast malignant melanoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es Accepted 2016-JUN-02 AT 16:05 BST AT 16:05 BST by MGT Biochimica et biophysica acta 2016 Only protein-protein interactions imex curation VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. Biochimica et biophysica acta 2016 imex curation Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain NSB1 has been stated by the authors to be of endogenous origin, not transfected and flag-tagged as stated in the text. Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es Accepted 2016-JUN-02 AT 16:05 BST AT 16:05 BST by MGT Biochimica et biophysica acta 2016 Only protein-protein interactions imex curation VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. Biochimica et biophysica acta 2016 imex curation Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es Accepted 2016-JUN-02 AT 16:05 BST AT 16:05 BST by MGT Biochimica et biophysica acta 2016 Only protein-protein interactions imex curation VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. Biochimica et biophysica acta 2016 imex curation Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es Accepted 2016-JUN-02 AT 16:05 BST AT 16:05 BST by MGT Biochimica et biophysica acta 2016 Only protein-protein interactions imex curation VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. Biochimica et biophysica acta 2016 imex curation Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es Accepted 2016-JUN-02 AT 16:05 BST AT 16:05 BST by MGT Biochimica et biophysica acta 2016 Only protein-protein interactions imex curation VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. Biochimica et biophysica acta 2016 imex curation Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-gm9607 Human GM9607 gm9607 ATM-/- fibroblast cell line GM9607 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es Accepted 2016-JUN-02 AT 16:05 BST AT 16:05 BST by MGT Biochimica et biophysica acta 2016 Only protein-protein interactions imex curation VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. Biochimica et biophysica acta 2016 imex curation Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-ht-144 Homo sapiens ht-144 Human fibroblast malignant melanoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es Accepted 2016-JUN-02 AT 16:05 BST AT 16:05 BST by MGT Biochimica et biophysica acta 2016 Only protein-protein interactions imex curation VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage. Biochimica et biophysica acta 2016 imex curation Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Monsalve DM., Campillo-Marcos I., Salzano M., Sanz-García M., Cantarero L., Lazo PA. 2015-11-26: Lazo P; Centro de Investigación del Cáncer, CSIC-Universidad de Salamanca, Spain Additional details on constructs and cell lines supplied by the authors. plazozbi@usal.es Accepted 2016-JUN-02 AT 16:05 BST AT 16:05 BST by MGT Biochimica et biophysica acta 2016 Only protein-protein interactions imex curation rnf8_human E3 ubiquitin-protein ligase RNF8 RNF8 KIAA0646 RING finger protein 8 RING-type E3 ubiquitin transferase RNF8 protein protein human Homo sapiens Human MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLCAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF 54650B2FFC9948B1 nbn_human Nibrin Nijmegen breakage syndrome protein 1 Cell cycle regulatory protein p95 NBN NBS1 NBS P95 protein protein human Homo sapiens Human MWKLLPAAGPAGGEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLSQTDEIPVLTLKDNSKYGTFVNEEKMQNGFSRTLKSGDGITFGVFGSKFRIEYEPLVACSSCLDVSGKTALNQAILQLGGFTVNNWTEECTHLVMVSVKVTIKTICALICGRPIVKPEYFTEFLKAVESKKQPPQIESFYPPLDEPSIGSKNVDLSGRQERKQIFKGKTFIFLNAKQHKKLSSAVVFGGGEARLITEENEEEHNFFLAPGTCVVDTGITNSQTLIPDCQKKWIQSIMDMLQRQGLRPIPEAEIGLAVIFMTTKNYCDPQGHPSTGLKTTTPGPSLSQGVSVDEKLMPSAPVNTTTYVADTESEQADTWDLSERPKEIKVSKMEQKFRMLSQDAPTVKESCKTSSNNNSMVSNTLAKMRIPNYQLSPTKLPSINKSKDRASQQQQTNSIRNYFQPSTKKRERDEENQEMSSCKSARIETSCSLLEQTQPATPSLWKNKEQHLSENEPVDTNSDNNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIEDEVLEQLFKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR DIP protein O60934 original sequence version: 65 DIP protein O60934 original sequence version: 84 DIP protein O60934 original sequence version: 96 DIP protein O60934 original sequence version: 131 DIP protein O60934 original sequence version: 133 DIP protein O60934 original sequence version: 128 DIP protein O60934 original sequence version: 99 DIP protein O60934 original sequence version: 85 CD602F09BA73DAB6 vrk1_human Serine/threonine-protein kinase VRK1 Vaccinia-related kinase 1 VRK1 protein protein human Homo sapiens Human MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK 5640C624BF059949 nbn-vrk1-1 7 14 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey physical association physical association Fig. 2A Interaction observed in ATM-/- cells and is independent of DNA damage. nbn-vrk1-2 3 14 unspecified role unspecified role bait bait ser-343 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm 15 unspecified role unspecified role prey prey physical association physical association Fig. 2A, 3C Interaction observed in ATM-/- cells and is independent of DNA damage. nbn-vrk1-3 11 14 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey physical association physical association Fig. 2A Interaction observed in ATM-/- cells and is independent of DNA damage. nbn-vrk1-4 10 14 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey physical association physical association Fig. 2A Interaction observed in ATM-/- cells and is independent of DNA damage. nbn-vrk1-5 6 14 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association Fig. 2B Interaction independent of DNA damage by Doxorubicin nbn-vrk1-6 2 14 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 2A Interaction independent of DNA damage by Doxorubicin vrk1-nbn-1 1 14 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 2A Interaction independent of DNA damage by Doxorubicin nbn-vrk1-8 8 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 2B Interaction independent of DNA damage by Doxorubicin vrk1-nbn-2 6 14 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association Fig. 2B Interaction independent of DNA damage by Doxorubicin nbn-vrk1-7 12 14 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 2C, 2D Interaction independent of DNA damage by Doxorubicin. Kinase-dead VRK1 (lys179glu) interacts with NBS1. vrk1-nbn-3 9 14 enzyme target enzyme target substrate substrate neutral component neutral component ser-343 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations phosphoamino acid analysis phosphoamino acid analysis certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm human-ht-144 Homo sapiens ht-144 Human fibroblast malignant melanoma 15 enzyme enzyme neutral component neutral component Q99986:p.Lys179Glu mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain K E Wed May 02 15:37:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys179glu' Tue Jun 30 19:23:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys179Glu' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Fig. 3D, 3E nbn-rnf8-1 8 14 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6A rnf8-vrk1-1 8 13 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6B Interaction independent of DNA damage by Doxorubicin nbn-vrk1-9 4 14 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 1A Ionising radiation (3Gy, 30 minutes) (XCO:0000039) nbn-vrk1-10 5 14 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 1B Ionising radiation (3Gy, 30 minutes) (XCO:0000039) Interaction observed in ATM-/- cells