MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Wnts grasp the WIF domain of Wnt Inhibitory Factor 1 at two distinct binding sites. Wnts grasp the WIF domain of Wnt Inhibitory Factor 1 at two distinct binding sites. FEBS letters 2015 imex curation Kerekes K., Bányai L., Patthy L. kerekes.krisztina@ttk.mta.hu, patthy.laszlo@ttk.mta.hu 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kerekes K., Bányai L., Patthy L. kerekes.krisztina@ttk.mta.hu, patthy.laszlo@ttk.mta.hu Accepted 2015-DEC-21 AT 16:18 GMT AT 16:18 GMT by LUANA FEBS letters 2015 Only protein-protein interactions imex curation imex curation wnt7a_human Protein Wnt-7a WNT7A protein protein human Homo sapiens Human MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK DIP protein O00755 original sequence version: 133 259EF506CFCD7AB0 wnt5a_human Protein Wnt-5a WNT5A protein protein human Homo sapiens Human MKKSIGILSPGVALGMAGSAMSSKFFLVALAIFFSFAQVVIEANSWWSLGMNNPVQMSEVYIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK DIP protein P41221 original sequence version: 59 50E73AC7FE96C7B5 wif1_human Wnt inhibitory factor 1 WIF1 UNQ191/PRO217 protein protein human Homo sapiens Human MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIW DIP protein Q9Y5W5 original sequence version: 99 32ADFA6644833E9D wif1-wnt5a-7 1 3 unspecified role unspecified role prey prey purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9Y5W5:p.Ile155Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain I R Wed May 02 19:21:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile155arg' Tue Jun 30 18:15:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile155Arg' direct interaction direct interaction f2a t1 t2 t4 wif1-wnt5a-8 1 2 unspecified role unspecified role prey prey purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait purified purified Q9Y5W5:p.Leu123Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L R Wed May 02 14:49:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu123arg' Tue Jun 30 18:43:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu123Arg' Q9Y5W5:p.Ile155Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I R Wed May 02 14:47:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile155arg' Tue Jun 30 20:01:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile155Arg' Q9Y5W5:p.Ile172Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I R Wed May 02 15:07:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile172arg' Tue Jun 30 15:50:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile172Arg' binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f2b t1 t2 t3 f4 t4 wif1-wnt7a-1 1 2 unspecified role unspecified role prey prey purified purified 4 unspecified role unspecified role bait bait purified purified Q9Y5W5:p.Ile155Arg mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain I R Wed May 02 18:23:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile155arg' Tue Jun 30 19:44:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile155Arg' binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction t4 f4 wif1-wnt5a-9 1 3 unspecified role unspecified role prey prey purified purified 4 unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9Y5W5:p.Ile155Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I R Wed May 02 17:08:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile155arg' Tue Jun 30 18:29:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile155Arg' direct interaction direct interaction t4 f4