MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Lil3 dimerization and chlorophyll binding in Arabidopsis thaliana. Lil3 dimerization and chlorophyll binding in Arabidopsis thaliana. FEBS letters 2015 imex curation Mork-Jansson AE., Gargano D., Kmiec K., Furnes C., Shevela D., Eichacker LA. lutz.eichacker@uis.no 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Mork-Jansson AE., Gargano D., Kmiec K., Furnes C., Shevela D., Eichacker LA. lutz.eichacker@uis.no Accepted 2015-NOV-10 AT 11:51 GMT AT 11:51 GMT by LUANA FEBS letters 2015 Only protein-protein interactions imex curation imex curation Lil3 dimerization and chlorophyll binding in Arabidopsis thaliana. Lil3 dimerization and chlorophyll binding in Arabidopsis thaliana. FEBS letters 2015 imex curation Mork-Jansson AE., Gargano D., Kmiec K., Furnes C., Shevela D., Eichacker LA. lutz.eichacker@uis.no 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Mork-Jansson AE., Gargano D., Kmiec K., Furnes C., Shevela D., Eichacker LA. lutz.eichacker@uis.no Accepted 2015-NOV-10 AT 11:51 GMT AT 11:51 GMT by LUANA FEBS letters 2015 Only protein-protein interactions imex curation imex curation Lil3 dimerization and chlorophyll binding in Arabidopsis thaliana. Lil3 dimerization and chlorophyll binding in Arabidopsis thaliana. FEBS letters 2015 imex curation Mork-Jansson AE., Gargano D., Kmiec K., Furnes C., Shevela D., Eichacker LA. lutz.eichacker@uis.no 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro mst microscale thermophoresis mst tag fluorescence tag visualisation by fluorescence tag fluorescence Mork-Jansson AE., Gargano D., Kmiec K., Furnes C., Shevela D., Eichacker LA. lutz.eichacker@uis.no Accepted 2015-NOV-10 AT 11:51 GMT AT 11:51 GMT by LUANA FEBS letters 2015 Only protein-protein interactions imex curation imex curation lil31_arath Light-harvesting complex-like protein 3 isotype 1, chloroplastic LIL3.1 LHC-like protein 3 isoform 1 dl4835w At4g17600 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MALFSPPISSSSLQNPNFIPKFSFSLLSSNRFSLLSVTRASSDSGSTSPTAAVSVEAPEPVEVIVKEPPQSTPAVKKEETATAKNVAVEGEEMKTTESVVKFQDARWINGTWDLKQFEKDGKTDWDSVIVAEAKRRKWLEENPETTSNDEPVLFDTSIIPWWAWIKRYHLPEAELLNGRAAMIGFFMAYFVDSLTGVGLVDQMGNFFCKTLLFVAVAGVLFIRKNEDVDKLKNLFDETTLYDKQWQAAWKNDDDESLGSKKK DIP protein Q9SYX1 original sequence version: 53 DA1EA332802CCCDD lil32_arath Light-harvesting complex-like protein 3 isotype 2, chloroplastic LIL3.2 LHC-like protein 3 isoform 2 K14A3.6 At5g47110 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSISMALFSPPISSSLQNPNLIPKISTSLLSTKRFSLISVPRASSDNGTTSPVVEIPKPASVAVEEVPVKSPAESSSASENGAVGGEATDSSTETVIKYQNAKWVNGTWDLKQFEKDGKTDWDSVIVSEAKRRKWLEDNPETTSNDELVVFDTSIIPWWAWMKRYHLPEAELLNGRAAMIGFFMAYFVDSLTGVGLVDQMGNFFCKTLLFVAVAGVLFIRKNEDLDKLKDLFDETTLYDKQWQAAWKEPDSSTVSSKK DIP protein Q6NKS4 original sequence version: 42 372F5DFC5FF508D8 lil3:1-q9ltb7_arath-1 2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1 lil3:1-lil3:1-1 2 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1 q9ltb7_arath-q9ltb7_arath-1 2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1 1-79 1 4 unspecified role unspecified role prey prey purified purified 4 unspecified role unspecified role bait bait purified purified direct interaction direct interaction f2a lil3:1-lil3:1-2 1 5 unspecified role unspecified role prey prey purified purified 5 unspecified role unspecified role bait bait purified purified direct interaction direct interaction f2b lil3:1-q9ltb7_arath-2 1 5 unspecified role unspecified role prey prey purified purified 4 unspecified role unspecified role bait bait purified purified direct interaction direct interaction f2c 1-80 3 4 unspecified role unspecified role neutral component neutral component purified purified fluorophore fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f3a lil3:1-q9ltb7_arath-3 3 5 unspecified role unspecified role neutral component neutral component purified purified fluorophore fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f3b