IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Detecting envelope stress by monitoring β-barrel assembly. Detecting envelope stress by monitoring β-barrel assembly. Cell 2014 imex curation Cho SH., Szewczyk J., Pesavento C., Zietek M., Banzhaf M., Roszczenko P., Asmar A., Laloux G., Hov AK., Leverrier P., Van der Henst C., Vertommen D., Typas A., Collet JF. typas@embl.de, jfcollet@uclouvain.be 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) crosslink cross-linking study crosslink sequence tag sequence tag identification sequence tag Cho SH., Szewczyk J., Pesavento C., Zietek M., Banzhaf M., Roszczenko P., Asmar A., Laloux G., Hov AK., Leverrier P., Van der Henst C., Vertommen D., Typas A., Collet JF. Crosslinking agent - 3,3′-dithiobis[sulfosuccinimidylpropionate] (DTSSP). IgaA-bound complexes were purified through a Nickel-nitriloacetic acid column, RCSF complexes isolated by coimmunoprecipitation. typas@embl.de, jfcollet@uclouvain.be Accepted 2015-OCT-14 AT 12:07 BST AT 12:07 BST by MGT Cell 2014 Only protein-protein interactions imex curation imex curation I've expanded my original exp-mod and changed participant detection to identification by weight to make that clearer. I don't think S2C is an association - its the reciprocal blot of the protein pairs seen in all the other expts. I'm not treating this as a pulldown, its a co-migration in gel hidden by a crosslink interaction detection method. Detecting envelope stress by monitoring β-barrel assembly. Detecting envelope stress by monitoring β-barrel assembly. Cell 2014 imex curation Cho SH., Szewczyk J., Pesavento C., Zietek M., Banzhaf M., Roszczenko P., Asmar A., Laloux G., Hov AK., Leverrier P., Van der Henst C., Vertommen D., Typas A., Collet JF. typas@embl.de, jfcollet@uclouvain.be 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Cho SH., Szewczyk J., Pesavento C., Zietek M., Banzhaf M., Roszczenko P., Asmar A., Laloux G., Hov AK., Leverrier P., Van der Henst C., Vertommen D., Typas A., Collet JF. typas@embl.de, jfcollet@uclouvain.be Accepted 2015-OCT-14 AT 12:07 BST AT 12:07 BST by MGT Cell 2014 Only protein-protein interactions imex curation imex curation I've expanded my original exp-mod and changed participant detection to identification by weight to make that clearer. I don't think S2C is an association - its the reciprocal blot of the protein pairs seen in all the other expts. I'm not treating this as a pulldown, its a co-migration in gel hidden by a crosslink interaction detection method. Detecting envelope stress by monitoring β-barrel assembly. Detecting envelope stress by monitoring β-barrel assembly. Cell 2014 imex curation Cho SH., Szewczyk J., Pesavento C., Zietek M., Banzhaf M., Roszczenko P., Asmar A., Laloux G., Hov AK., Leverrier P., Van der Henst C., Vertommen D., Typas A., Collet JF. typas@embl.de, jfcollet@uclouvain.be 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Cho SH., Szewczyk J., Pesavento C., Zietek M., Banzhaf M., Roszczenko P., Asmar A., Laloux G., Hov AK., Leverrier P., Van der Henst C., Vertommen D., Typas A., Collet JF. The crosslinkable amino acid p-benzoyl-L-phenylalanine (pBpa) was inserted after the indicated amino acid residue. Crosslinking was then induced by UV light. The components of the complex were in part identified by molecular weight comparison with those previously identified by western blot, and in other cases by western blot of both components Photocrosslinking typas@embl.de, jfcollet@uclouvain.be Accepted 2015-OCT-14 AT 12:07 BST AT 12:07 BST by MGT Cell 2014 Only protein-protein interactions imex curation imex curation I've expanded my original exp-mod and changed participant detection to identification by weight to make that clearer. I don't think S2C is an association - its the reciprocal blot of the protein pairs seen in all the other expts. I'm not treating this as a pulldown, its a co-migration in gel hidden by a crosslink interaction detection method. Detecting envelope stress by monitoring β-barrel assembly. Detecting envelope stress by monitoring β-barrel assembly. Cell 2014 imex curation Cho SH., Szewczyk J., Pesavento C., Zietek M., Banzhaf M., Roszczenko P., Asmar A., Laloux G., Hov AK., Leverrier P., Van der Henst C., Vertommen D., Typas A., Collet JF. typas@embl.de, jfcollet@uclouvain.be 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) crosslink cross-linking study crosslink sequence tag sequence tag identification sequence tag Cho SH., Szewczyk J., Pesavento C., Zietek M., Banzhaf M., Roszczenko P., Asmar A., Laloux G., Hov AK., Leverrier P., Van der Henst C., Vertommen D., Typas A., Collet JF. The crosslinkable amino acid p-benzoyl-L-phenylalanine (pBpa) was inserted after the indicated amino acid residue. Photocrosslinking typas@embl.de, jfcollet@uclouvain.be Accepted 2015-OCT-14 AT 12:07 BST AT 12:07 BST by MGT Cell 2014 Only protein-protein interactions imex curation imex curation I've expanded my original exp-mod and changed participant detection to identification by weight to make that clearer. I don't think S2C is an association - its the reciprocal blot of the protein pairs seen in all the other expts. I'm not treating this as a pulldown, its a co-migration in gel hidden by a crosslink interaction detection method. Detecting envelope stress by monitoring β-barrel assembly. Detecting envelope stress by monitoring β-barrel assembly. Cell 2014 imex curation Cho SH., Szewczyk J., Pesavento C., Zietek M., Banzhaf M., Roszczenko P., Asmar A., Laloux G., Hov AK., Leverrier P., Van der Henst C., Vertommen D., Typas A., Collet JF. typas@embl.de, jfcollet@uclouvain.be 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) crosslink cross-linking study crosslink weight identificat confirmation by molecular weight weight identificat Cho SH., Szewczyk J., Pesavento C., Zietek M., Banzhaf M., Roszczenko P., Asmar A., Laloux G., Hov AK., Leverrier P., Van der Henst C., Vertommen D., Typas A., Collet JF. Crosslinking agent - 3,3′-dithiobis[sulfosuccinimidylpropionate] (DTSSP). Immunoprecipitated complexes were shown to have remained cross-linked following co-migration in SDS-PAGE by western blotting of both bait and prey. Once the initial bait prey paring had been conformed by reciprocal western blotting, the protein pairs were subsequently identified by molecular weight. typas@embl.de, jfcollet@uclouvain.be Accepted 2015-OCT-14 AT 12:07 BST AT 12:07 BST by MGT Cell 2014 Only protein-protein interactions imex curation imex curation I've expanded my original exp-mod and changed participant detection to identification by weight to make that clearer. I don't think S2C is an association - its the reciprocal blot of the protein pairs seen in all the other expts. I'm not treating this as a pulldown, its a co-migration in gel hidden by a crosslink interaction detection method. bama_ecoli Outer membrane protein assembly factor BamA bamA Omp85 yaeT yzzN yzzY JW0172 b0177 protein protein ecoli Escherichia coli (strain K12) MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW DIP protein P0A940 original sequence version: 84 DIP protein P0A940 original sequence version: 102 DIP protein P0A940 original sequence version: 103 DDCE4C6D341664EB ompc_ecoli Outer membrane porin C ompC meoA par b2215 Outer membrane protein 1B JW2203 Porin OmpC Outer membrane protein C protein protein ecoli Escherichia coli (strain K12) MKVKVLSLLVPALLVAGAANAAEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF DIP protein P06996 original sequence version: 129 DIP protein P06996 original sequence version: null 6A49370CC8A1A225 fkba_ecoli FKBP-type peptidyl-prolyl cis-trans isomerase FkpA fkpA b3347 JW3309 yzzS Rotamase protein protein ecoli Escherichia coli (strain K12) MKSLFKVTLLATTMAVALHAPITFAAEAAKPATAADSKAAFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAPKADAKPEADAKAADSAKK DIP protein P45523 original sequence version: null DBC73B8676BB63EF ompf_ecoli Outer membrane porin F ompF cmlB tolF coa cry Porin OmpF Outer membrane protein 1A Outer membrane protein IA Outer membrane protein B b0929 JW0912 Outer membrane protein F protein protein ecoli Escherichia coli (strain K12) MMKRNILAVIVPALLVAGTANAAEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF 3F0974D96DB65464 3F0974D96DB65464 rcsf_ecoli Outer membrane lipoprotein RcsF rcsF b0196 JW0192 protein protein ecoli Escherichia coli (strain K12) MRALPICLVALMLSGCSMLSRSPVEPVQSTAPQPKAEPAKPKAPRATPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAVLLHSCEVTSGTPGCYRQAVCIGSALNITAK 824F82151C07BB41 degp_ecoli Periplasmic serine endoprotease DegP degP htrA ptd b0161 JW0157 Heat shock protein DegP Protease Do protein protein ecoli Escherichia coli (strain K12) MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ DIP protein P0C0V0 original sequence version: 94 DIP protein P0C0V0 original sequence version: 75 DIP protein P0C0V0 original sequence version: 62 DIP protein P0C0V0 original sequence version: 84 DIP protein P0C0V0 original sequence version: 67 5482E596F74B6D5F ompa_ecoli Outer membrane protein A ompA tolG tut con Outer membrane protein II* b0957 JW0940 Outer membrane porin A Outer membrane protein 3A Outer membrane protein B Outer membrane protein d protein protein ecoli Escherichia coli (strain K12) MKKTAIAIAVALAGFATVAQAAPKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA DIP protein P0A910 original sequence version: 81 DIP protein P0A910 original sequence version: 79 DIP protein P0A910 original sequence version: 61 DIP protein P0A910 original sequence version: 54 DIP protein P0A910 original sequence version: 67 DIP protein P0A910 original sequence version: 88 DIP protein P0A910 original sequence version: 93 195147734CDF8B04 igaa_ecoli Putative membrane protein IgaA homolog yrfF b3398 JW3361 protein protein ecoli Escherichia coli (strain K12) MSTIVIFLAALLACSLLAGWLIKVRSRRRQLPWTNAFADAQTRKLTPEERSAVENYLESLTQVLQVPGPTGASAAPISLALNAESNNVMMLTHAITRYGISTDDPNKWRYYLDSVEVHLPPFWEQYINDENTVELIHTDSLPLVISLNGHTLQEYMQETRSYALQPVPSTQASIRGEESEQIELLNIRKETHEEYALSRPRGLREALLIVASFLMFFFCLITPDVFVPWLAGGALLLLGAGLWGLFAPPAKSSLREIHCLRGTPRRWGLFGENDQEQINNISLGIIDLVYPAHWQPYIAQDLGQQTDIDIYLDRHVVRQGRYLSLHDEVKNFPLQHWLRSTIIAAGSLLVLFMLLFWIPLDMPLKFTLSWMKGAQTIEATSVKQLADAGVRVGDTLRISGTGMCNIRTSGTWSAKTNSPFLPFDCSQIIWNDARSLPLPESELVNKATALTEAVNRQLHPKPEDESRVSASLRSAIQKSGMVLLDDFGDIVLKTADLCSAKDDCVRLKNALVNLGNSKDWDALVKRANAGKLDGVNVLLRPVSAESLDNLVATSTAPFITHETARAAQSLNSPAPGGFLIVSDEGSDFVDQPWPSASLYDYPPQEQWNAFQKLAQMLMHTPFNAEGIVTKIFTDANGTQHIGLHPIPDRSGLWRYLSTTLLLLTMLGSAIYNGVQAWRRYQRHRTRMMEIQAYYESCLNPQLITPSESLIE DIP protein P45800 original sequence version: 67 C9222D0F3403BA03 lpp_ecoli Major outer membrane lipoprotein Lpp lpp mlpA mulI b1677 JW1667 Braun lipoprotein Murein-lipoprotein protein protein ecoli Escherichia coli (strain K12) MKATKLVLGAVILGSTLLAGCSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRK DIP protein P69776 original sequence version: 52 19F41D5251913C93 rcsf-yrff-1 1 12 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component periplasmic region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal LamB signal sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role neutral component neutral component association association Supp Table 1, Supp. Figure 2C rcsf-ompa-1 5 12 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 2A, 2B, 3A-D, 4B, 5B, Supp Fig. 2C, 5B rcsf-bama-1 5 6 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 2A, 2B, 3A-D, 4B, 5B Supp Fig. 2C, 4D, 5B The BamA-RcsF complex is more stress responsive than the OmpA-RcsF complex. Polymyxin-B A22 MreB inhibitor Mecillinam (CHEBI:51208) rcsf-lpp-1 5 10 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component physical association physical association Supp Fig. 2D rcsf-bama-2 3 6 weight identificat confirmation by molecular weight weight identificat western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range P69411:p.Lys40_Pro41insXaa mutation mutation certain certain sequence position certain certain certain sequence position certain KP KXP Feature - insertion of the crosslinkable amino acid p-benzoyl-L-phenylalanine (pBpa) Fri Jul 22 10:52:20 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys40lys_unc' Wed May 02 15:33:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys40lys_xaa' Tue Jun 30 17:18:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys40_Pro41insXaa' P69411:p.Gln79_Asp80insXaa mutation mutation certain certain sequence position certain certain certain sequence position certain QD QXD Feature - insertion of crosslinkable amino acid p-benzoyl-L-phenylalanine (pBpa) Fri Jul 22 10:53:37 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'gln79gln_unc' Wed May 02 18:30:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln79gln_xaa' Tue Jun 30 16:27:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln79_Asp80insXaa' P69411:p.Lys134delinsLysXaa mutation mutation certain certain sequence position certain certain certain sequence position certain K KX Feature - insertion of crosslinkable amino acid p-benzoyl-L-phenylalanine (pBpa) Fri Jul 22 10:53:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys134lys_unc' Wed May 02 14:26:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys134lys_xaa' Wed Jun 13 17:53:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys134delinsLysXaa' Tue Jun 30 17:36:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys134delinsLysXaa' P69411:p.Pro116_Gly117insXaa mutation mutation certain certain sequence position certain certain certain sequence position certain PG PXG Feature - insertion of crosslinkable amino acid p-benzoyl-L-phenylalanine (pBpa) Fri Jul 22 11:10:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'pro116pro_unc' Wed May 02 16:47:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro116pro_xaa' Tue Jun 30 16:22:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro116_Gly117insXaa' physical association physical association Fig. 2C Supp Fig.3D rcsf-ompa-3 3 12 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range P69411:p.Lys40_Pro41insXaa mutation mutation certain certain sequence position certain certain certain sequence position certain KP KXP Feature - insertion of crosslinkable amino acid p-benzoyl-L-phenylalanine (pBpa) Fri Jul 22 11:06:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys40lys_unc' Wed May 02 15:41:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys40lys_xaa' Tue Jun 30 18:12:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys40_Pro41insXaa' P69411:p.Gln79_Asp80insXaa mutation mutation certain certain sequence position certain certain certain sequence position certain QD QXD Feature - insertion of crosslinkable amino acid p-benzoyl-L-phenylalanine (pBpa) Fri Jul 22 10:51:50 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'gln79gln_unc' Wed May 02 16:05:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln79gln_xaa' Tue Jun 30 17:27:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln79_Asp80insXaa' P69411:p.Ala31_Pro32insXaa mutation mutation certain certain sequence position certain certain certain sequence position certain AP AXP Feature - insertion of crosslinkable amino acid p-benzoyl-L-phenylalanine (pBpa) Fri Jul 22 11:10:50 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ala31ala_unc' Wed May 02 15:33:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala31ala_xaa' Tue Jun 30 16:22:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala31_Pro32insXaa' P69411:p.Lys35_Ala36insXaa mutation mutation certain certain sequence position certain certain certain sequence position certain KA KXA Feature - insertion of crosslinkable amino acid p-benzoyl-L-phenylalanine (pBpa) Fri Jul 22 11:15:03 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys35lys_unc' Wed May 02 17:30:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys35lys_xaa' Tue Jun 30 19:51:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys35_Ala36insXaa' P69411:p.Pro116_Gly117insXaa mutation mutation certain certain sequence position certain certain certain sequence position certain PG PXG Feature - insertion of crosslinkable amino acid p-benzoyl-L-phenylalanine (pBpa) Fri Jul 22 11:00:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'pro116pro_unc' Wed May 02 15:55:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro116pro_xaa' Tue Jun 30 16:22:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro116_Gly117insXaa' P69411:p.Lys134delinsLysXaa mutation mutation certain certain sequence position certain certain certain sequence position certain K KX Feature - insertion of crosslinkable amino acid p-benzoyl-L-phenylalanine (pBpa) Fri Jul 22 11:09:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys134lys_unc' Wed May 02 16:10:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys134lys_xaa' Wed Jun 13 19:01:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys134delinsLysXaa' Tue Jun 30 17:47:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys134delinsLysXaa' physical association physical association Fig. 2C, Supp Fig. 3B, 3D, 3F rcsf-yrff-2 2 10 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey purified purified periplasmic region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 55 58 direct interaction direct interaction Fig. 1C ompa-ompc-1 1 9 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component association association Supp Table 2A ompa-rcsf-1 4 12 weight identificat confirmation by molecular weight weight identificat sequence tag sequence tag identification sequence tag unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range P69411:p.Lys40_Pro41insXaa mutation mutation certain certain sequence position certain certain certain sequence position certain KP KXP Feature - insertion of crosslinkable amino acid p-benzoyl-L-phenylalanine (pBpa) Fri Jul 22 11:01:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys40lys_unc' Wed May 02 18:37:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys40lys_xaa' Tue Jun 30 19:18:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys40_Pro41insXaa' physical association physical association Sup. Fig. 3E, Supp Table 2B