MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The pentapeptide LQVVR plays a pivotal role in human cystatin C fibrillization. The pentapeptide LQVVR plays a pivotal role in human cystatin C fibrillization. FEBS Lett. (0014-5793) 2015 imex curation Tsiolaki P.L., Hamodrakas S.J., Iconomidou V.A. veconom@biol.uoa.gr 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro light microscopy light microscopy peptide synthesis peptide synthesis Tsiolaki P.L., Hamodrakas S.J., Iconomidou V.A. veconom@biol.uoa.gr Accepted 2015-FEB-13 by LUANA FEBS Lett. (0014-5793) 2015 Only protein-protein interactions imex curation The pentapeptide LQVVR plays a pivotal role in human cystatin C fibrillization. The pentapeptide LQVVR plays a pivotal role in human cystatin C fibrillization. FEBS Lett. (0014-5793) 2015 imex curation Tsiolaki P.L., Hamodrakas S.J., Iconomidou V.A. veconom@biol.uoa.gr 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction peptide synthesis peptide synthesis Tsiolaki P.L., Hamodrakas S.J., Iconomidou V.A. veconom@biol.uoa.gr Accepted 2015-FEB-13 by LUANA FEBS Lett. (0014-5793) 2015 Only protein-protein interactions imex curation The pentapeptide LQVVR plays a pivotal role in human cystatin C fibrillization. The pentapeptide LQVVR plays a pivotal role in human cystatin C fibrillization. FEBS Lett. (0014-5793) 2015 imex curation Tsiolaki P.L., Hamodrakas S.J., Iconomidou V.A. veconom@biol.uoa.gr 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro ir spectrometry infrared spectroscopy ir spectrometry peptide synthesis peptide synthesis Tsiolaki P.L., Hamodrakas S.J., Iconomidou V.A. veconom@biol.uoa.gr Accepted 2015-FEB-13 by LUANA FEBS Lett. (0014-5793) 2015 Only protein-protein interactions imex curation The pentapeptide LQVVR plays a pivotal role in human cystatin C fibrillization. The pentapeptide LQVVR plays a pivotal role in human cystatin C fibrillization. FEBS Lett. (0014-5793) 2015 imex curation Tsiolaki P.L., Hamodrakas S.J., Iconomidou V.A. veconom@biol.uoa.gr 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy peptide synthesis peptide synthesis Tsiolaki P.L., Hamodrakas S.J., Iconomidou V.A. veconom@biol.uoa.gr Accepted 2015-FEB-13 by LUANA FEBS Lett. (0014-5793) 2015 Only protein-protein interactions imex curation cytc_human Cystatin-C Cystatin-3 Neuroendocrine basic polypeptide Gamma-trace Post-gamma-globulin CST3 protein protein human Homo sapiens Human MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA 75EF049CAE2E8B2B cst3-cst3 2 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f4 we determined a novel aggregation-potent segment of HCC, 47LQVVR51, which was initially predicted as such, by implementing AMYLPRED, our aggregation propensity prediction algorithm [28]. This ‘aggregationprone’ peptide segment was synthesized (see Section 2) and here we present experimental results, verifying its strong aggregation propensity to form amyloid fibrils. X-ray diffraction patterns from fibers formed from LQVVR peptide fibrils showed two strong reflections at 4.62 Å and 11.63 Å (Fig. 4). These reflections appear as rings due to the poor alignment of the constituent fibrils. cst3-cst3-3 4 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true direct interaction direct interaction f2 we determined a novel aggregation-potent segment of HCC, 47LQVVR51, which was initially predicted as such, by implementing AMYLPRED, our aggregation propensity prediction algorithm [28]. This ‘aggregationprone’ peptide segment was synthesized (see Section 2) and here we present experimental results, verifying its strong aggregation propensity to form amyloid fibrils. cst3-cst3-4 1 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true direct interaction direct interaction f3 we determined a novel aggregation-potent segment of HCC, 47LQVVR51, which was initially predicted as such, by implementing AMYLPRED, our aggregation propensity prediction algorithm [28]. This ‘aggregationprone’ peptide segment was synthesized (see Section 2) and here we present experimental results, verifying its strong aggregation propensity to form amyloid fibrils. cst3-cst3-5 3 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain true direct interaction direct interaction t1 f5 we determined a novel aggregation-potent segment of HCC, 47LQVVR51, which was initially predicted as such, by implementing AMYLPRED, our aggregation propensity prediction algorithm [28]. This ‘aggregationprone’ peptide segment was synthesized (see Section 2) and here we present experimental results, verifying its strong aggregation propensity to form amyloid fibrils.