MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Protein-protein interaction studies provide evidence for electron transfer from ferredoxin to lipoic acid synthase in Toxoplasma gondii. Protein-protein interaction studies provide evidence for electron transfer from ferredoxin to lipoic acid synthase in Toxoplasma gondii. FEBS Lett. (0014-5793) 2015 imex curation Frohnecke N., Klein S., Seeber F. seeberf@rki.de 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Frohnecke N., Klein S., Seeber F. seeberf@rki.de Accepted 2015-FEB-12 by LUANA FEBS Lett. (0014-5793) 2015 Only protein-protein interactions imex curation Protein-protein interaction studies provide evidence for electron transfer from ferredoxin to lipoic acid synthase in Toxoplasma gondii. Protein-protein interaction studies provide evidence for electron transfer from ferredoxin to lipoic acid synthase in Toxoplasma gondii. FEBS Lett. (0014-5793) 2015 imex curation Frohnecke N., Klein S., Seeber F. seeberf@rki.de 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions ecoli Escherichia coli (strain K12) reverse two hybrid reverse two hybrid predetermined predetermined participant predetermined Frohnecke N., Klein S., Seeber F. seeberf@rki.de Accepted 2015-FEB-12 by LUANA FEBS Lett. (0014-5793) 2015 Only protein-protein interactions imex curation lipa_toxgo Lipoyl synthase, apicoplast lipA Lipoate synthase Lipoic acid synthase protein protein toxgo Toxoplasma gondii MAYFFDFPTDTWVEDASPGGPPKRAFGHGLAAGSSHFASPVSRRRLPTITALLLFSLLSASQSGALSVSQCSRRVSLGPLLSRVSSVSCTPSAAASALASSLYPTDSLSSVEGSVAPRPPPSSLAFVLRRVPPAAYSSSLSPSVLRFKHSLPRPLQGSLVCAPGILGGAAGSARFAGCCGSQGRSCGSGKNPELPLKGSKDEVIPRVGTSTAGPRPDWFHVPAPQAASRGAEESRYQQLQKQIRGLDLHTVCEEAKCPNIGECWNGGTATLILLGDTCTRGCRFCAIKTSSKPPPPDPLEPEKVADAVAKWDIDYVVMTSVDRDDMPDGGAGHFARTVQLVKKAKPSMLIECLVSDFQGMEESVRTLAQSGLDVYAHNIETVRRLTPYVRDKRAKYDQSLRVLHLAKQFNPSLFTKSSIMLGLGETSEEVVRTLRDLRDHDVDVVTLGQYLRPTKQQLGVVEYVTPETFKKYQDIAEEMGFKYVASGPLVRSSYKAGEYYMKHLIDDARKHGRRETVKQVKLEADVGTLKGTTTTFQVNEKEA 1DDCD0A1150680E6 fer_plaf7 Ferredoxin, apicoplast FD PF3D7_1318100 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MNIVILLLILTFSIKHSNTYKLKNTYIPINYMYHNNKNILRSQKSKLFLNFLSNNQLANSNKQTCFFKSNIKSSISNIDNYDYIRKRYINTSNKNKLFYNITLRTNDGEKKIECNEDEYILDASERQNVELPYSCRGGSCSTCAAKLVEGEVDNDDQSYLDEEQIKKKYILLCTCYPKSDCVIETHKEDELHDM mint ACE738196F816D3E q8mpf8_toxgo Ferredoxin fdx protein protein toxgo Toxoplasma gondii HEAAFLGPSASRPSSTVSASSAEATLPTLGRQPGASASSLVSSAPLPRPCLGAAQRTTSLWSHSATRLCSEGATLEAGWRKAEPRNVRLRSHSRLFHRIKLQTPDGETKELECAEDEYILDAAEAAGIELPYSCRGGSCSTCAGKLLVGSVDGSEQVYLDDAQQKKGYVLLCTAYPKEDCTILTHQEDQLHSEGGDE DEC81D0E02FC6E64 fdx-lipa 1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association f3 lipa-fdx 1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association f3 lipa-fdx-1 2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell physical association physical association f4