IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ ATRX directs binding of PRC2 to Xist RNA and Polycomb targets. ATRX directs binding of PRC2 to Xist RNA and Polycomb targets. Cell (0092-8674) 2014 imex curation Sarma K., Cifuentes-Rojas C., Ergun A., Del Rosario A., Jeon Y., White F., Sadreyev R., Lee J.T. RNA interactions not added as multiple Xist entries in RNACentral and Ensembl transcripts. lee@molbio.mgh.harvard.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sarma K., Cifuentes-Rojas C., Ergun A., Del Rosario A., Jeon Y., White F., Sadreyev R., Lee J.T. RNA interactions not added as multiple Xist entries in RNACentral and Ensembl transcripts. Additional details on constructs obtained from the authors lee@molbio.mgh.harvard.edu Accepted 2015-AUG-12 by PPORRAS Cell (0092-8674) 2014 Only protein-protein interactions imex curation ATRX directs binding of PRC2 to Xist RNA and Polycomb targets. ATRX directs binding of PRC2 to Xist RNA and Polycomb targets. Cell (0092-8674) 2014 imex curation Sarma K., Cifuentes-Rojas C., Ergun A., Del Rosario A., Jeon Y., White F., Sadreyev R., Lee J.T. RNA interactions not added as multiple Xist entries in RNACentral and Ensembl transcripts. lee@molbio.mgh.harvard.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Sarma K., Cifuentes-Rojas C., Ergun A., Del Rosario A., Jeon Y., White F., Sadreyev R., Lee J.T. RNA interactions not added as multiple Xist entries in RNACentral and Ensembl transcripts. Additional details on constructs obtained from the authors lee@molbio.mgh.harvard.edu Accepted 2015-AUG-12 by PPORRAS Cell (0092-8674) 2014 Only protein-protein interactions imex curation ATRX directs binding of PRC2 to Xist RNA and Polycomb targets. ATRX directs binding of PRC2 to Xist RNA and Polycomb targets. Cell (0092-8674) 2014 imex curation Sarma K., Cifuentes-Rojas C., Ergun A., Del Rosario A., Jeon Y., White F., Sadreyev R., Lee J.T. RNA interactions not added as multiple Xist entries in RNACentral and Ensembl transcripts. lee@molbio.mgh.harvard.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sarma K., Cifuentes-Rojas C., Ergun A., Del Rosario A., Jeon Y., White F., Sadreyev R., Lee J.T. RNA interactions not added as multiple Xist entries in RNACentral and Ensembl transcripts. Additional details on constructs obtained from the authors lee@molbio.mgh.harvard.edu Accepted 2015-AUG-12 by PPORRAS Cell (0092-8674) 2014 Only protein-protein interactions imex curation ATRX directs binding of PRC2 to Xist RNA and Polycomb targets. ATRX directs binding of PRC2 to Xist RNA and Polycomb targets. Cell (0092-8674) 2014 imex curation Sarma K., Cifuentes-Rojas C., Ergun A., Del Rosario A., Jeon Y., White F., Sadreyev R., Lee J.T. RNA interactions not added as multiple Xist entries in RNACentral and Ensembl transcripts. lee@molbio.mgh.harvard.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sarma K., Cifuentes-Rojas C., Ergun A., Del Rosario A., Jeon Y., White F., Sadreyev R., Lee J.T. RNA interactions not added as multiple Xist entries in RNACentral and Ensembl transcripts. Additional details on constructs obtained from the authors lee@molbio.mgh.harvard.edu Accepted 2015-AUG-12 by PPORRAS Cell (0092-8674) 2014 Only protein-protein interactions imex curation ATRX directs binding of PRC2 to Xist RNA and Polycomb targets. ATRX directs binding of PRC2 to Xist RNA and Polycomb targets. Cell (0092-8674) 2014 imex curation Sarma K., Cifuentes-Rojas C., Ergun A., Del Rosario A., Jeon Y., White F., Sadreyev R., Lee J.T. RNA interactions not added as multiple Xist entries in RNACentral and Ensembl transcripts. lee@molbio.mgh.harvard.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sarma K., Cifuentes-Rojas C., Ergun A., Del Rosario A., Jeon Y., White F., Sadreyev R., Lee J.T. RNA interactions not added as multiple Xist entries in RNACentral and Ensembl transcripts. Additional details on constructs obtained from the authors lee@molbio.mgh.harvard.edu Accepted 2015-AUG-12 by PPORRAS Cell (0092-8674) 2014 Only protein-protein interactions imex curation hxd11_mouse_gene HXD11 gene gene gene mouse Mus musculus Mouse hxd8_mouse_gene Homeobox protein Hox-D8 Hoxd8 Hox-4.3 Hoxd-8 Homeobox protein Hox-4.3 Homeobox protein Hox-5.4 gene gene mouse Mus musculus Mouse h2ay_human Core histone macro-H2A.1 MACROH2A1 H2AFY Histone H2A.y Medulloblastoma antigen MU-MB-50.205 protein protein human Homo sapiens Human MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKGKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQEMAKLDAN DIP protein O75367 original sequence version: 111 37DED989EF7E69DC gpr26_mouse_gene G-protein coupled receptor 26 Gpr26 gene gene mouse Mus musculus Mouse ticn2_mouse_gene Testican-2 Spock2 Ticn2 SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 2 gene gene mouse Mus musculus Mouse cbx1_human Chromobox protein homolog 1 CBX1 CBX Heterochromatin protein 1 homolog beta Modifier 1 protein M31 Heterochromatin protein p25 p25beta HP1Hsbeta protein protein human Homo sapiens Human MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN DIP protein P83916 original sequence version: 29 DIP protein P83916 original sequence version: 105 DIP protein P83916 original sequence version: 101 BE687AF9C66E48E3 h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62805 original sequence version: 68 DIP protein P62805 original sequence version: 111 DIP protein P62805 original sequence version: 94 DIP protein P62805 original sequence version: 97 DIP protein P62805 original sequence version: 116 DIP protein P62805 original sequence version: 105 DIP protein P62805 original sequence version: 120 DIP protein P62805 original sequence version: 144 DIP protein P62805 original sequence version: 150 DIP protein P62805 original sequence version: 154 DIP protein P62805 original sequence version: 156 DIP protein P62805 original sequence version: 112 DIP protein P62805 original sequence version: 121 DIP protein P62805 original sequence version: 123 DIP protein P62805 original sequence version: 126 DIP protein P62805 original sequence version: 132 DIP protein P62805 original sequence version: 136 DIP protein P62805 original sequence version: 119 A9E5DFD3F8B97598 t200a_mouse_gene Transmembrane protein 200A Tmem200a Kiaa1913 gene gene mouse Mus musculus Mouse atrx_human Transcriptional regulator ATRX ATRX RAD54L XH2 ATP-dependent helicase ATRX X-linked helicase II X-linked nuclear protein Znf-HX protein protein human Homo sapiens Human MTAEPMSESKLNTLVQKLHDFLAHSSEESEETSSPPRLAMNQNTDKISGSGSNSDMMENSKEEGTSSSEKSKSSGSSRSKRKPSIVTKYVESDDEKPLDDETVNEDASNENSENDITMQSLPKGTVIVQPEPVLNEDKDDFKGPEFRSRSKMKTENLKKRGEDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKKKIKVDSEKSNKVYEHTSRFSPKKTSSNCNGEEKKLDDSCSGSVTYSYSALIVPKEMIKKAKKLIETTANMNSSYVKFLKQATDNSEISSATKLRQLKAFKSVLADIKKAHLALEEDLNSEFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLSRKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKEEPQYEPANTSEDLDMDIVSVPSSVPEDIFENLETAMEVQSSVDHQGDGSSGTEQEVESSSVKLNISSKDNRGGIKSKTTAKVTKELYVKLTPVSLSNSPIKGADCQEVPQDKDGYKSCGLNPKLEKCGLGQENSDNEHLVENEVSLLLEESDLRRSPRVKTTPLRRPTETNPVTSNSDEECNETVKEKQKLSVPVRKKDKRNSSDSAIDNPKPNKLPKSKQSETVDQNSDSDEMLAILKEVSRMSHSSSSDTDINEIHTNHKTLYDLKTQAGKDDKGKRKRKSSTSGSDFDTKKGKSAKSSIISKKKRQTQSESSNYDSELEKEIKSMSKIGAARTTKKRIPNTKDFDSSEDEKHSKKGMDNQGHKNLKTSQEGSSDDAERKQERETFSSAEGTVDKDTTIMELRDRLPKKQQASASTDGVDKLSGKEQSFTSLEVRKVAETKEKSKHLKTKTCKKVQDGLSDIAEKFLKKDQSDETSEDDKKQSKKGTEEKKKPSDFKKKVIKMEQQYESSSDGTEKLPEREEICHFPKGIKQIKNGTTDGEKKSKKIRDKTSKKKDELSDYAEKSTGKGDSCDSSEDKKSKNGAYGREKKRCKLLGKSSRKRQDCSSSDTEKYSMKEDGCNSSDKRLKRIELRERRNLSSKRNTKEIQSGSSSSDAEESSEDNKKKKQRTSSKKKAVIVKEKKRNSLRTSTKRKQADITSSSSSDIEDDDQNSIGEGSSDEQKIKPVTENLVLSSHTGFCQSSGDEALSKSVPVTVDDDDDDNDPENRIAKKMLLEEIKANLSSDEDGSSDDEPEEGKKRTGKQNEENPGDEEAKNQVNSESDSDSEESKKPRYRHRLLRHKLTVSDGESGEEKKTKPKEHKEVKGRNRRKVSSEDSEDSDFQESGVSEEVSESEDEQRPRTRSAKKAELEENQRSYKQKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEEDENDDSKSPGKGRKKIRKILKDDKLRTETQNALKEEEERRKRIAEREREREKLREVIEIEDASPTKCPITTKLVLDEDEETKEPLVQVHRNMVIKLKPHQVDGVQFMWDCCCESVKKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDFSTALVVCPLNTALNWMNEFEKWQEGLKDDEKLEVSELATVKRPQERSYMLQRWQEDGGVMIIGYEMYRNLAQGRNVKSRKLKEIFNKALVDPGPDFVVCDEGHILKNEASAVSKAMNSIRSRRRIILTGTPLQNNLIEYHCMVNFIKENLLGSIKEFRNRFINPIQNGQCADSTMVDVRVMKKRAHILYEMLAGCVQRKDYTALTKFLPPKHEYVLAVRMTSIQCKLYQYYLDHLTGVGNNSEGGRGKAGAKLFQDFQMLSRIWTHPWCLQLDYISKENKGYFDEDSMDEFIASDSDETSMSLSSDDYTKKKKKGKKGKKDSSSSGSGSDNDVEVIKVWNSRSRGGGEGNVDETGNNPSVSLKLEESKATSSSNPSSPAPDWYKDFVTDADAEVLEHSGKMVLLFEILRMAEEIGDKVLVFSQSLISLDLIEDFLELASREKTEDKDKPLIYKGEGKWLRNIDYYRLDGSTTAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFDASWNPSYDIQSIFRVYRFGQTKPVYVYRFLAQGTMEDKIYDRQVTKQSLSFRVVDQQQVERHFTMNELTELYTFEPDLLDDPNSEKKKKRDTPMLPKDTILAELLQIHKEHIVGYHEHDSLLDHKEEEELTEEERKAAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRRLQQQYNQQQQQQMTYQQATLGHLMMPKPPNLIMNPSNYQQIDMRGMYQPVAGGMQPPPLQRAPPPMRSKNPGPSQGKSM 637E341F6A4B29C6 hxd1_mouse_gene-1 Homeobox protein Hox-D1 Hoxd1 Hox-4.9 Hoxd-1 Homeobox protein Hox-4.9 gene gene mouse Mus musculus Mouse xist_mouse_gene XIST gene gene gene mouse Mus musculus Mouse evx2_mouse_gene Homeobox even-skipped homolog protein 2 Evx2 Evx-2 gene gene mouse Mus musculus Mouse hxd9_mouse_gene Homeobox protein Hox-D9 Hoxd9 Hox-4.4 Hoxd-9 Homeobox protein Hox-4.4 Homeobox protein Hox-5.2 gene gene mouse Mus musculus Mouse hxd10_mouse_gene Hoxd10 gene gene gene mouse Mus musculus Mouse hxd13_mouse_gene Homeobox protein Hox-D13 Hoxd13 Hox-4.8 Homeobox protein Hox-4.8 gene gene mouse Mus musculus Mouse hxd3_mouse_gene Homeobox protein Hox-D3 Hoxd3 Hox-4.1 Hoxd-3 Homeobox protein Hox-4.1 Homeobox protein MH-19 gene gene mouse Mus musculus Mouse atrx_mouse Transcriptional regulator ATRX Xnp ATP-dependent helicase ATRX HP1 alpha-interacting protein HP1-BP38 protein Heterochromatin protein 2 X-linked nuclear protein Atrx Hp1bp2 protein protein mouse Mus musculus Mouse MTAEPMSGNKLSTLVQKLHDFLAHSSEESEETCSSPRLVMNQSTDKICGSGLNSDMMENNKEEGASTSEKSRSSGSSRSKRKPSIVTKYVESDDEKPTDENVNEKAATENSENDITMQSLPKGTVIVQPEPVLNEDKDDFKGPEFRSRSKMKADNLKKRGEDGLHGIVSCTACGQQVNHFQKDSIYRHPSLKVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICQPEPLLDLVTACNSVFENLEQLLQQNKKKIKVDSEKTSKVCDQTSKFSPKKSSSSCNGEEKKLEESCSGSVSSTYSHSALSVPKEMIKKTTKLIETTSNMNSSYIKFLKQAADNSEMTSAMKLCQLKSFKSVLDDIKKAHLALEEDLNSEIQALDDVHKEKNTKDLKSTDAKSETKLGKGEKSYSTEKREFLKLDARSSVKAIDGEEQRAHKSTSGEHKGSGRKDGSQYEPTNTPEDLDMDIVSVPSSVPEDIFDSLESAMEVQSSADYQGDGNSGTEPELESSSVKLNVSSKDSRGNIKSKVTAKVRKELFVKLTPVSLSNSPIKGVDCQEVSQEKNGRKSSGVARSSEKCRPREEISDHENNVTILLEDSDLRRSPRVKTTPLRRQTESNPAMSNSDEESNGTMKEKQKMSGPIRKKDKRNSADCATDNPKPHKVPKAKQPVIGDQNSDSDEMLAVLKEASQMGHSSSSDTDINEPQMNHKGKTGKDDNGKRKRKNSTSGSDFDTKKGKSTETSIISKKKRQNYSESSNYDSELEREIKTMSRIGAARKSVPEKKEEDSSEDEKQGKKVVDNGGHERAKTTQEGSSADDTGDTEGRQGGSCSIAGGSIEKVRSGVEFREMLCKPGVSSDGAEKPSVKEENVNSPEDKRVSKTKEKTKHLRSRQSRKGKGGSSDGTDRFPKKEQSDESSEGEKKQSRQRPGTKGKKAPDLKGETLKREQEWDSSSDGTERLPEEEEIGPFSKGIKQSKTDTAGGEKKGKKWKDKSCEKKEELSDSVDKLPGKGDSCDSSEDKKTRNRVSLREKKRFSLPAKSPGKRPECSSSDTEKSLKGQCCDSTEKRPKRIDLRERRNSSSKRNTKEVKSASSSSDAEGSSEDNKKQKKQRTSAKKKTGNTKEKKRNSLRATPKRKQVDITSSSSDIGDDDQNSAGEESSDEQKIKPVTENLVLPSHTGFCQSSGDEALSKSVPATVDDDDDDNDPENRIAKKMLLEEIKANLSSDEDGSSDDEPDGGGKKRIGKQSEESPADDGELRREQLAVNQVNSESDSDSEESKKPRYRHRLLRHKLTLSDGESGEEKPTKPKEHKEAKGRNRRKVSSEDSEDTDFQESGVSEEVSESEDEQRPRTRSAKKAELEENQRSYKQKKKRRRIKVQEDSSSENKSHSEEDKKEGDEEDEEDEDEDEEDENDDSKSPGKGRKKIRKILKDDKLRTETQNALKEEEERRKRIAEREREREKLREVIEIEDASPTKCPITTKLVLDENEETKEPLVQVHRNMVIKLKPHQVDGVQFMWDCCCESVEKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDFSTALVVCPLNTALNWMNEFEKWQEGLNDNEKLEVSELATVKRPQERSYMLQRWQEDGGVMIIGYEMYRNLAQGRNVKSRKLKDIFNKALVDPGPDFVVCDEGHILKNEASAVSKAMNSIKSRRRIILTGTPLQNNLIEYHCMVNFIKENLLGSIKEFRNRFINPIQNGQCADSTMVDVRVMKKRAHILYEMLAGCVQRKDYTALTKFLPPKHEYVLAVRMTAIQCKLYQYYLDHLTGVGNSTEGGRGKAGAKLFQDFQMLSRIWTHPWCLQLDYISKENKGYFDEDSMDEFIASDSDETSKSLSSDEKKKPKGKKGKKDSSSSGSGSDNDVEVIKVWNSRSRGGGDGNVDDTGNNPSVSLKLDESKTTSTSNPSSPAPDWYKDFVTDTDAEVLEHSGKMVLLFEILRMAEEIGDKVLVFSQSLISLDLIEDFLELASREKTEDKEKPLIYKGEGKWIRNIDYYRLDGSTNAQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFDASWNPSYDIQSIFRVYRFGQTKPVYVYRFLAQGTMEDKIYDRQVTKQSLSFRVVDQQQVERHFTMNELTELYTFEPDLLDDPNSEKKKKRDTPMLPKDTILAELLQIHKEHIVGYHEHDSLLDHKEEEELTEEERKAAWAEYEAEKKGLTMRFNIPTGTNLPPVTFTSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSMTAVRIQPLEDIISTVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLINCVQRILMNRRLQQQYTQQQQQQLTYQQATLSHLMMPKPPNLIMTPSNYQQIDMRGMYQSVAGGMQPPPLQRAPPPTVRSKNPGPSPGKSM DIP protein Q61687 original sequence version: 129 DIP protein Q61687 original sequence version: 140 B2E2218B6CC791EC par12_mouse_gene Poly [ADP-ribose] polymerase 12 Parp12 Zc3hdc1 ADP-ribosyltransferase diphtheria toxin-like 12 Zinc finger CCCH domain-containing protein 1 gene gene mouse Mus musculus Mouse hxc13_mouse_gene Homeobox protein Hox-C13 Hoxc13 Hoxc-13 gene gene mouse Mus musculus Mouse hxc9_mouse_gene Homeobox protein Hox-C9 Hoxc9 Hox-3.2 Hoxc-9 Homeobox protein Hox-3.2 gene gene mouse Mus musculus Mouse hxd12_mouse_gene Homeobox protein Hox-D12 Hoxd12 Hox-4.7 Hoxd-12 Homeobox protein Hox-4.7 Homeobox protein Hox-5.6 gene gene mouse Mus musculus Mouse ezh2_human Histone-lysine N-methyltransferase EZH2 KMT6 Enhancer of zeste homolog 2 ENX-1 Lysine N-methyltransferase 6 EZH2 protein protein human Homo sapiens Human MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP DIP protein Q15910 original sequence version: 97 DIP protein Q15910 original sequence version: 94 DIP protein Q15910 original sequence version: 92 DIP protein Q15910 original sequence version: 96 DIP protein Q15910 original sequence version: 122 DIP protein Q15910 original sequence version: 100 1B5029EB9D509BE5 klhl31_mouse_gene gene gene mouse Mus musculus Mouse parp1_human Poly [ADP-ribose] polymerase 1 PARP1 ADPRT PPOL NAD(+) ADP-ribosyltransferase 1 Poly[ADP-ribose] synthase 1 ADP-ribosyltransferase diphtheria toxin-like 1 DNA ADP-ribosyltransferase PARP1 Protein poly-ADP-ribosyltransferase PARP1 protein protein human Homo sapiens Human MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW DIP protein P09874 original sequence version: 189 DIP protein P09874 original sequence version: 183 DIP protein P09874 original sequence version: 166 DIP protein P09874 original sequence version: 117 DIP protein P09874 original sequence version: 143 DIP protein P09874 original sequence version: 136 DIP protein P09874 original sequence version: 137 DIP protein P09874 original sequence version: 147 DIP protein P09874 original sequence version: 193 DIP protein P09874 original sequence version: 202 DIP protein P09874 original sequence version: 171 DIP protein P09874 original sequence version: 153 DIP protein P09874 original sequence version: 175 6A5FC01EB91C046B rn19b_mouse_gene E3 ubiquitin-protein ligase RNF19B Rnf19b Ibrdc3 Nklam IBR domain-containing protein 3 Natural killer lytic-associated molecule RING finger protein 19B gene gene mouse Mus musculus Mouse hnf6_mouse_gene Hepatocyte nuclear factor 6 Onecut1 Hnf6 Hnf6a One cut domain family member 1 One cut homeobox 1 gene gene mouse Mus musculus Mouse mecp2_human Methyl-CpG-binding protein 2 MECP2 protein protein human Homo sapiens Human MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESPKAPVPLLPPLPPPPPEPESSEDPTSPPEPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS DIP protein P51608 original sequence version: 182 DIP protein P51608-1 original sequence version: 195 EB6A33233AEDA566 ezh2_mouse Histone-lysine N-methyltransferase EZH2 Ezh2 Enx1h Enhancer of zeste homolog 2 ENX-1 protein protein mouse Mus musculus Mouse MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKTMFSSNRQKILERTETLNQEWKQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPAQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPDEREEKQKDLEDNRDDKETCPPRKFPADKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTISVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPVPTEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP 7442C751E13EA24B hxc12_mouse_gene Homeobox protein Hox-C12 Hoxc12 Hox-3.8 Hoxc-12 Homeobox protein Hox-3.8 gene gene mouse Mus musculus Mouse atrx-cbx1-2 2 14 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 29 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 32 unspecified role unspecified role prey prey association association Fig. 1A, Supp Fig. 1A-B Hostones H1, H2 and H3 were also present in the immunoprecipitation but could not be ascribed to a single gene product. atrx-cbx1-1 5 29 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true association association Fig. 1A atrx-ezh2-1 4 27 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association EZH2 was produced as the Polycomb Repressive Complex 2 but only EZH2 was shown to be present in the interaction. RNA was also present in the interaction mix. Fig. 4A-B ezh2-atrx 1 27 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range true c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range true spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association EZH2 was produced as the Polycomb Repressive Complex 2 but only EZH2 was shown to be present in the interaction. RNA was also present in the interaction mix. Fig. 4B, 4D atrx-xist-1 3 22 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association Figs. 5D, 5E, Supp Fig. 4D ATRX binds along full-length of XIST gene. ezh2-gpr26-1 3 33 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 6G Loss of ATRX resulted in loss of EZH2 binding to the promoter and a relative reduction in H3K27me3 across the gene body ezh2-tmem200a-1 3 33 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association Fig. 6G Loss of ATRX resulted in loss of EZH2 binding to the promoter region. ezh2-evx2-1 3 17 unspecified role unspecified role prey prey 33 unspecified role unspecified role bait bait association association Fig. 7A EZH2 and H3K27me3 levels were significantly reduced in ATRX -/- cells. ezh2-hoxd13-1 3 33 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey association association Fig. 7A, Supp. Fig. 6A EZH2 and H3K27me3 levels were significantly reduced in ATRX -/- cells. Q61188 decreases activity of ENSMUSG00000001819 ezh2-hoxd12-1 3 33 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey association association Fig. 7A EZH2 and H3K27me3 levels were significantly reduced in ATRX -/- cells. ezh2-hxd11-1 3 6 unspecified role unspecified role prey prey 33 unspecified role unspecified role bait bait association association Fig. 7A, Supp. Fig. 6A EZH2 and H3K27me3 levels were significantly reduced in ATRX -/- cells. ezh2-hxd10-1 3 19 unspecified role unspecified role prey prey 33 unspecified role unspecified role bait bait association association Fig. 7A, Supp. Fig. 6A EZH2 and H3K27me3 levels were significantly reduced in ATRX -/- cells. ezh2-hoxd9-1 3 33 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey association association Fig. 7A, Supp. Fig. 6A EZH2 and H3K27me3 levels were significantly reduced in ATRX -/- cells. ezh2-hoxd8-1 3 33 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey association association Fig. 7A, Supp. Fig. 6A EZH2 and H3K27me3 levels were significantly reduced in ATRX -/- cells. ezh2-hoxd3-1 3 21 unspecified role unspecified role prey prey 33 unspecified role unspecified role bait bait association association Fig. 7A, Supp. Fig. 6A EZH2 and H3K27me3 levels were significantly reduced in ATRX -/- cells. ezh2-hoxd1-1 3 15 unspecified role unspecified role prey prey 33 unspecified role unspecified role bait bait association association Fig. 7A, Supp. Fig. 6A EZH2 and H3K27me3 levels were significantly reduced in ATRX -/- cells. Q61188 decreases activity of ENSMUSG00000042448 ezh2-rnf19b-1 3 33 unspecified role unspecified role bait bait 30 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 7B EZH2 and H3K27me3 levels were significantly reduced in ATRX -/- cells. Q61188 decreases activity of ENSMUSG00000028793 ezh2-parp12-1 3 23 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 33 unspecified role unspecified role bait bait association association Supp. Fig. 6B EZH2 and H3K27me3 levels were significantly reduced in ATRX -/- cells. Q61188 decreases activity of ENSMUSG00000038507 ezh2-spock2-1 3 10 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 33 unspecified role unspecified role bait bait association association Fig. 7B EZH2 and H3K27me3 levels were significantly reduced in ATRX -/- cells. Q61188 decreases activity of ENSMUSG00000058297 ezh2-hoxc13-1 3 24 unspecified role unspecified role prey prey 33 unspecified role unspecified role bait bait association association Supp. Fig. 6B EZH2 and H3K27me3 levels were significantly reduced in ATRX -/- cells. ezh2-hoxc12-1 3 34 unspecified role unspecified role prey prey 33 unspecified role unspecified role bait bait association association Supp. Fig. 6B EZH2 and H3K27me3 levels were significantly reduced in ATRX -/- cells. Q61188 decreases activity of ENSMUSG00000050328 ezh2-hoxc9-1 3 25 unspecified role unspecified role prey prey 33 unspecified role unspecified role bait bait association association Supp. Fig. 6B EZH2 and H3K27me3 levels were significantly reduced in ATRX -/- cells. ezh2-onecut1-1 3 31 unspecified role unspecified role prey prey 33 unspecified role unspecified role bait bait association association SUpp. Fig. 7 ezh2-klhl31-1 3 28 unspecified role unspecified role prey prey 33 unspecified role unspecified role bait bait association association Supp. Fig. 7